BLASTX nr result
ID: Glycyrrhiza31_contig00018238
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00018238 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN11899.1 Protein suppressor of white apricot [Glycine soja] 57 4e-07 >KHN11899.1 Protein suppressor of white apricot [Glycine soja] Length = 830 Score = 56.6 bits (135), Expect = 4e-07 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = -3 Query: 209 QGIIVNMIMIAPRMKNTTVLEDDIERIACQTMGIGILDIRVNIIAHRMMSIGTEAE 42 QGIIV ++ P M +TT+ +DI I CQTM I IL I + II H MMSIG EAE Sbjct: 772 QGIIVINMIAPPLMMSTTLPNNDIGMITCQTMSIDILAILMKIIVHLMMSIGIEAE 827