BLASTX nr result
ID: Glycyrrhiza31_contig00017993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017993 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016172200.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 8e-37 XP_015932691.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 8e-37 XP_015872949.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 6e-36 KYP36656.1 Pentatricopeptide repeat-containing protein At2g17670... 137 6e-36 XP_018856538.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 1e-35 XP_007134550.1 hypothetical protein PHAVU_010G056500g [Phaseolus... 135 2e-35 XP_011022210.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 3e-35 XP_002306437.1 pentatricopeptide repeat-containing family protei... 135 3e-35 KRH48741.1 hypothetical protein GLYMA_07G109000 [Glycine max] 130 1e-34 KHN25072.1 Pentatricopeptide repeat-containing protein [Glycine ... 128 2e-34 XP_006467049.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 2e-34 XP_006425315.1 hypothetical protein CICLE_v10025555mg [Citrus cl... 133 2e-34 KHN10889.1 Pentatricopeptide repeat-containing protein [Glycine ... 127 3e-34 XP_010683001.1 PREDICTED: pentatricopeptide repeat-containing pr... 132 4e-34 GAV78568.1 PPR_1 domain-containing protein/PPR_2 domain-containi... 131 7e-34 XP_017440829.1 PREDICTED: pentatricopeptide repeat-containing pr... 131 7e-34 XP_012065351.1 PREDICTED: pentatricopeptide repeat-containing pr... 131 7e-34 OAY60961.1 hypothetical protein MANES_01G153300 [Manihot esculen... 131 1e-33 XP_014633403.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 130 1e-33 XP_019431621.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 4e-33 >XP_016172200.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Arachis ipaensis] Length = 475 Score = 139 bits (351), Expect = 8e-37 Identities = 69/78 (88%), Positives = 74/78 (94%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KA+ELYGVMKSGGLKLETASYATFVRALCRD +IAEAYEVFDYAVESKSLTDV AYS Sbjct: 398 LEKAMELYGVMKSGGLKLETASYATFVRALCRDDRIAEAYEVFDYAVESKSLTDVVAYST 457 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKAKE+G A+ Sbjct: 458 LESTLKWLKKAKEKGQAV 475 >XP_015932691.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Arachis duranensis] Length = 475 Score = 139 bits (351), Expect = 8e-37 Identities = 69/78 (88%), Positives = 74/78 (94%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KA+ELYGVMKSGGLKLETASYATFVRALCRD +IAEAYEVFDYAVESKSLTDV AYS Sbjct: 398 LEKAMELYGVMKSGGLKLETASYATFVRALCRDDRIAEAYEVFDYAVESKSLTDVVAYST 457 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKAKE+G A+ Sbjct: 458 LESTLKWLKKAKEKGQAV 475 >XP_015872949.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670, partial [Ziziphus jujuba] Length = 323 Score = 134 bits (337), Expect = 6e-36 Identities = 64/78 (82%), Positives = 71/78 (91%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 LDK +ELYGVMK GG+KL+TA YATFVRALCRDG+IAEAYEVFDYA+ESKSLT VAAYS Sbjct: 246 LDKGIELYGVMKEGGMKLDTACYATFVRALCRDGRIAEAYEVFDYAIESKSLTTVAAYST 305 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL KA+EQG A+ Sbjct: 306 LESTLKWLNKAREQGKAV 323 >KYP36656.1 Pentatricopeptide repeat-containing protein At2g17670 family [Cajanus cajan] Length = 456 Score = 137 bits (344), Expect = 6e-36 Identities = 66/78 (84%), Positives = 74/78 (94%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KAVE YGV+K GGLKL+TA+YATFVRALCRDG++AEAYEVFDYAVESKSLTDVAAYS Sbjct: 379 LEKAVEFYGVIKEGGLKLDTAAYATFVRALCRDGRVAEAYEVFDYAVESKSLTDVAAYST 438 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL+KAKEQG A+ Sbjct: 439 LESTLKWLRKAKEQGLAV 456 >XP_018856538.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Juglans regia] XP_018856539.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Juglans regia] XP_018856540.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Juglans regia] Length = 466 Score = 136 bits (343), Expect = 1e-35 Identities = 66/78 (84%), Positives = 74/78 (94%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KA+ELY VMKSG +KLETA+YATFVRALCR+G+IAEAYEVFDY VESKSLTDVAAY+ Sbjct: 389 LEKALELYAVMKSGDMKLETAAYATFVRALCREGRIAEAYEVFDYVVESKSLTDVAAYTT 448 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKW+KKAKEQGHAI Sbjct: 449 LESTLKWVKKAKEQGHAI 466 >XP_007134550.1 hypothetical protein PHAVU_010G056500g [Phaseolus vulgaris] ESW06544.1 hypothetical protein PHAVU_010G056500g [Phaseolus vulgaris] Length = 462 Score = 135 bits (341), Expect = 2e-35 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KA+E YGV+K GGLK +TASY TFVRALCRDG++AEAYEVFDYAVESKSLTDVAAYS Sbjct: 385 LEKAIEFYGVIKEGGLKFDTASYGTFVRALCRDGRVAEAYEVFDYAVESKSLTDVAAYST 444 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKAKEQG A+ Sbjct: 445 LESTLKWLKKAKEQGLAV 462 >XP_011022210.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] XP_011022211.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] XP_011022212.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] XP_011022213.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] XP_011022215.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Populus euphratica] Length = 462 Score = 135 bits (340), Expect = 3e-35 Identities = 65/78 (83%), Positives = 74/78 (94%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+K VELYGV+K GG+KLETASYATFVRALCR+G++AEAYEVFDYAVESKSLTDVAAY+ Sbjct: 385 LNKGVELYGVIKKGGMKLETASYATFVRALCREGRVAEAYEVFDYAVESKSLTDVAAYTT 444 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKA+EQG A+ Sbjct: 445 LESTLKWLKKAREQGLAV 462 >XP_002306437.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE93433.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 462 Score = 135 bits (340), Expect = 3e-35 Identities = 65/78 (83%), Positives = 74/78 (94%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+K VELYGV+K GG+KLETASYATFVRALCR+G++AEAYEVFDYAVESKSLTDVAAY+ Sbjct: 385 LNKGVELYGVIKKGGMKLETASYATFVRALCREGRVAEAYEVFDYAVESKSLTDVAAYTT 444 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKA+EQG A+ Sbjct: 445 LESTLKWLKKAREQGLAV 462 >KRH48741.1 hypothetical protein GLYMA_07G109000 [Glycine max] Length = 316 Score = 130 bits (328), Expect = 1e-34 Identities = 64/78 (82%), Positives = 73/78 (93%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 ++KAV+ Y V+++GGLKL+TASY TFVRALCRDG+IAEAYEVFDYAVESKSLTDVAAYS Sbjct: 239 VEKAVKFYQVIRAGGLKLDTASYGTFVRALCRDGRIAEAYEVFDYAVESKSLTDVAAYST 298 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL+KAKEQG AI Sbjct: 299 LESTLKWLRKAKEQGLAI 316 >KHN25072.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 246 Score = 128 bits (322), Expect = 2e-34 Identities = 63/78 (80%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 ++KAV+ Y V+++ GLKL+TASY TFVRALCRDG+IAEAYEVFDYAVESKSLTDVAAYS Sbjct: 169 VEKAVKFYQVIRASGLKLDTASYGTFVRALCRDGRIAEAYEVFDYAVESKSLTDVAAYST 228 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL+KAKEQG AI Sbjct: 229 LESTLKWLRKAKEQGLAI 246 >XP_006467049.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Citrus sinensis] XP_006467050.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Citrus sinensis] XP_006467051.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Citrus sinensis] Length = 465 Score = 133 bits (334), Expect = 2e-34 Identities = 63/78 (80%), Positives = 71/78 (91%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 ++K +ELY MK GG+KLETA+YAT VRALCR GK+AEAYEVFDYAVESKSLTDVAAY+ Sbjct: 388 MEKGIELYRAMKEGGVKLETAAYATLVRALCRHGKVAEAYEVFDYAVESKSLTDVAAYTT 447 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKAKEQGHA+ Sbjct: 448 LESTLKWLKKAKEQGHAV 465 >XP_006425315.1 hypothetical protein CICLE_v10025555mg [Citrus clementina] ESR38555.1 hypothetical protein CICLE_v10025555mg [Citrus clementina] Length = 465 Score = 133 bits (334), Expect = 2e-34 Identities = 63/78 (80%), Positives = 71/78 (91%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 ++K +ELY MK GG+KLETA+YAT VRALCR GK+AEAYEVFDYAVESKSLTDVAAY+ Sbjct: 388 MEKGIELYRAMKEGGVKLETAAYATLVRALCRHGKVAEAYEVFDYAVESKSLTDVAAYTT 447 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKAKEQGHA+ Sbjct: 448 LESTLKWLKKAKEQGHAV 465 >KHN10889.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 214 Score = 127 bits (318), Expect = 3e-34 Identities = 60/75 (80%), Positives = 70/75 (93%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 ++KAVE YGV+++GGLKL+TASY TFVRALCR+G+IAE YEVFDYAVES+SLTD AAYS Sbjct: 137 VEKAVEFYGVIRAGGLKLDTASYGTFVRALCREGRIAEKYEVFDYAVESESLTDAAAYST 196 Query: 203 LESTLKWLKKAKEQG 159 LESTLKWL+KAKEQG Sbjct: 197 LESTLKWLRKAKEQG 211 >XP_010683001.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Beta vulgaris subsp. vulgaris] KMT06882.1 hypothetical protein BVRB_6g152210 [Beta vulgaris subsp. vulgaris] Length = 470 Score = 132 bits (332), Expect = 4e-34 Identities = 64/78 (82%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 LDK +ELYGVMKSGG+KLETASYATF+RALCR+G+ AEAYEVFDYAVESKSLTD AAYS Sbjct: 393 LDKGMELYGVMKSGGVKLETASYATFLRALCREGRAAEAYEVFDYAVESKSLTDFAAYST 452 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKK +E+G A+ Sbjct: 453 LESTLKWLKKTREKGLAV 470 >GAV78568.1 PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 464 Score = 131 bits (330), Expect = 7e-34 Identities = 62/78 (79%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L K +ELYGVMK+G +KLETASYATFVRALCR+G++AEAYE+FDYA+ESKSLTDVAAYS Sbjct: 387 LQKGIELYGVMKAGDMKLETASYATFVRALCREGRVAEAYEIFDYAIESKSLTDVAAYST 446 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL+KAK QG A+ Sbjct: 447 LESTLKWLRKAKGQGLAV 464 >XP_017440829.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Vigna angularis] KOM58683.1 hypothetical protein LR48_Vigan11g171700 [Vigna angularis] BAT96767.1 hypothetical protein VIGAN_09006300 [Vigna angularis var. angularis] Length = 464 Score = 131 bits (330), Expect = 7e-34 Identities = 64/78 (82%), Positives = 70/78 (89%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KA E YGV+K GGLKL+TASY TFVRALCRDG++AEAYEVFDYAV SKSLTDVAAY Sbjct: 387 LEKATEFYGVIKEGGLKLDTASYGTFVRALCRDGRVAEAYEVFDYAVASKSLTDVAAYLT 446 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKAKEQG A+ Sbjct: 447 LESTLKWLKKAKEQGLAV 464 >XP_012065351.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Jatropha curcas] XP_012065352.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Jatropha curcas] KDP43734.1 hypothetical protein JCGZ_22361 [Jatropha curcas] Length = 467 Score = 131 bits (330), Expect = 7e-34 Identities = 64/78 (82%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+K VELY +MK G +KLETASYATFVRALCR+GK+AEAYEVFDYAVESKSLTDVAAY+ Sbjct: 390 LEKGVELYQLMKEGDMKLETASYATFVRALCREGKVAEAYEVFDYAVESKSLTDVAAYTT 449 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKA+EQG A+ Sbjct: 450 LESTLKWLKKAREQGLAV 467 >OAY60961.1 hypothetical protein MANES_01G153300 [Manihot esculenta] OAY60962.1 hypothetical protein MANES_01G153300 [Manihot esculenta] Length = 468 Score = 131 bits (329), Expect = 1e-33 Identities = 63/78 (80%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+K +ELY VMK GG+KLETASYATFVRALCR+G++A+AYEVFDYAVESKSL DVAAYS Sbjct: 391 LEKGIELYLVMKEGGMKLETASYATFVRALCREGRVADAYEVFDYAVESKSLADVAAYST 450 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWLKKA+EQG A+ Sbjct: 451 LESTLKWLKKAREQGLAV 468 >XP_014633403.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g17670-like [Glycine max] Length = 456 Score = 130 bits (328), Expect = 1e-33 Identities = 64/78 (82%), Positives = 73/78 (93%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 ++KAV+ Y V+++GGLKL+TASY TFVRALCRDG+IAEAYEVFDYAVESKSLTDVAAYS Sbjct: 379 VEKAVKFYQVIRAGGLKLDTASYGTFVRALCRDGRIAEAYEVFDYAVESKSLTDVAAYST 438 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL+KAKEQG AI Sbjct: 439 LESTLKWLRKAKEQGLAI 456 >XP_019431621.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Lupinus angustifolius] XP_019431622.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17670 [Lupinus angustifolius] OIW20736.1 hypothetical protein TanjilG_21799 [Lupinus angustifolius] Length = 468 Score = 129 bits (325), Expect = 4e-33 Identities = 62/78 (79%), Positives = 72/78 (92%) Frame = -3 Query: 383 LDKAVELYGVMKSGGLKLETASYATFVRALCRDGKIAEAYEVFDYAVESKSLTDVAAYSA 204 L+KAVE Y +MKSGG+KLETASYAT VR LCR+G++A+AYEVFDYAVESKSLTDVAAY+ Sbjct: 391 LEKAVEFYEMMKSGGMKLETASYATMVRVLCREGRVADAYEVFDYAVESKSLTDVAAYTT 450 Query: 203 LESTLKWLKKAKEQGHAI 150 LESTLKWL+KAKEQG A+ Sbjct: 451 LESTLKWLRKAKEQGLAV 468