BLASTX nr result
ID: Glycyrrhiza31_contig00017870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017870 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU26551.1 hypothetical protein TSUD_266650 [Trifolium subterran... 54 2e-07 >GAU26551.1 hypothetical protein TSUD_266650 [Trifolium subterraneum] Length = 64 Score = 54.3 bits (129), Expect = 2e-07 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = +3 Query: 261 MCLIIKYSF--ANKVVPPSELPLFILDEIGCLVHCPCLYCAQATEV 392 MCL+++ SF AN+ VPPSEL + ILDEIGCLV C L AQ EV Sbjct: 1 MCLLVENSFVEANEAVPPSELSVIILDEIGCLVQCSYLVRAQPIEV 46