BLASTX nr result
ID: Glycyrrhiza31_contig00017856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017856 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003602613.1 F-box protein interaction domain protein [Medicag... 55 1e-06 XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 54 3e-06 GAU28216.1 hypothetical protein TSUD_118230 [Trifolium subterran... 54 4e-06 XP_003594087.1 F-box protein interaction domain protein [Medicag... 53 5e-06 XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 53 5e-06 >XP_003602613.1 F-box protein interaction domain protein [Medicago truncatula] AES72864.1 F-box protein interaction domain protein [Medicago truncatula] Length = 348 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 302 LIVHNSKIGTYKIREVQNWNVWVVPEVYVESLVSPCS 192 L V++SK GT KI E+QN N W+ PEVYVESL+SPCS Sbjct: 312 LAVYDSKNGTLKIPEIQNTNGWIDPEVYVESLISPCS 348 >XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Lupinus angustifolius] OIV95875.1 hypothetical protein TanjilG_06851 [Lupinus angustifolius] Length = 367 Score = 53.9 bits (128), Expect = 3e-06 Identities = 20/37 (54%), Positives = 32/37 (86%) Frame = -3 Query: 302 LIVHNSKIGTYKIREVQNWNVWVVPEVYVESLVSPCS 192 L+V+NS+ GT+++ E+Q+ + W +PE+YVESL+SPCS Sbjct: 331 LVVYNSRNGTFRVPEIQDISGWAIPEIYVESLISPCS 367 >GAU28216.1 hypothetical protein TSUD_118230 [Trifolium subterraneum] Length = 395 Score = 53.5 bits (127), Expect = 4e-06 Identities = 21/37 (56%), Positives = 32/37 (86%) Frame = -3 Query: 302 LIVHNSKIGTYKIREVQNWNVWVVPEVYVESLVSPCS 192 L+V++S+ GT+ I E+QN N+W+ P+VY+ESL+SPCS Sbjct: 359 LVVYDSENGTWHIHEIQNTNLWMNPKVYIESLISPCS 395 >XP_003594087.1 F-box protein interaction domain protein [Medicago truncatula] AES64338.1 F-box protein interaction domain protein [Medicago truncatula] Length = 375 Score = 53.1 bits (126), Expect = 5e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -3 Query: 302 LIVHNSKIGTYKIREVQNWNVWVVPEVYVESLVSPCS 192 L+V+NS+ GT+K E+Q+ N W+VP+VY ESL+SPCS Sbjct: 339 LVVYNSRDGTFKTPEIQHINRWLVPQVYQESLISPCS 375 >XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 405 Score = 53.1 bits (126), Expect = 5e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -3 Query: 302 LIVHNSKIGTYKIREVQNWNVWVVPEVYVESLVSPC 195 L+V+NS+ GT+K ++QN N W+VPE+Y ESL+SPC Sbjct: 367 LVVYNSRDGTFKTPQIQNINDWMVPEIYQESLISPC 402