BLASTX nr result
ID: Glycyrrhiza31_contig00017658
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017658 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004490581.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 67 6e-11 GAU25711.1 hypothetical protein TSUD_216400 [Trifolium subterran... 65 6e-10 XP_003615584.1 ATP-dependent zinc metalloprotease FTSH protein [... 53 6e-06 >XP_004490581.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like [Cicer arietinum] Length = 804 Score = 67.4 bits (163), Expect = 6e-11 Identities = 37/61 (60%), Positives = 42/61 (68%) Frame = -2 Query: 310 IYLHSYSAKSNFHHHWRKQNARRFVVPNSVPVRVLRHASFLRDSRRFDLWGGLKLNNDGA 131 IYLHS HH+R NA RFV PNS P+RVLRHA+F +D +RFDLW GLKLNN Sbjct: 16 IYLHS--------HHFR--NAHRFV-PNSSPIRVLRHANFFKDFKRFDLWRGLKLNNTDL 64 Query: 130 R 128 R Sbjct: 65 R 65 >GAU25711.1 hypothetical protein TSUD_216400 [Trifolium subterraneum] Length = 797 Score = 64.7 bits (156), Expect = 6e-10 Identities = 36/59 (61%), Positives = 42/59 (71%) Frame = -2 Query: 310 IYLHSYSAKSNFHHHWRKQNARRFVVPNSVPVRVLRHASFLRDSRRFDLWGGLKLNNDG 134 IYLHS HH+R NARRFV PNS P+RVLR A+FL+D +FDLW GLKLN+ G Sbjct: 15 IYLHS--------HHFR--NARRFV-PNSAPIRVLRDANFLKDFGKFDLWRGLKLNSKG 62 >XP_003615584.1 ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] AES98542.1 ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] Length = 793 Score = 53.1 bits (126), Expect = 6e-06 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = -2 Query: 310 IYLHSYSAKSNFHHHWRKQNARRFVVPNSVPVRVLRHASFLRDSRRFDLWGGL--KLNN- 140 I+LHS HH+R NARRFV+PNS +RVLR + FL + +F+LW GL KL+N Sbjct: 15 IFLHS--------HHFR--NARRFVIPNSPSIRVLRDSIFLNNFGKFELWKGLNTKLSNF 64 Query: 139 DGAR 128 DG R Sbjct: 65 DGLR 68