BLASTX nr result
ID: Glycyrrhiza31_contig00017398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017398 (317 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019464718.1 PREDICTED: heavy metal-associated isoprenylated p... 57 3e-07 XP_019457664.1 PREDICTED: heavy metal-associated isoprenylated p... 55 1e-06 XP_010037390.1 PREDICTED: heavy metal-associated isoprenylated p... 53 6e-06 >XP_019464718.1 PREDICTED: heavy metal-associated isoprenylated plant protein 7-like [Lupinus angustifolius] OIW00258.1 hypothetical protein TanjilG_27509 [Lupinus angustifolius] Length = 324 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/33 (81%), Positives = 28/33 (84%), Gaps = 4/33 (12%) Frame = +3 Query: 231 SKGGKD----QPAPPPEIVLKVFMHCEGCARKV 317 SK GK+ QPAPPPEIVLKVFMHCEGCARKV Sbjct: 42 SKDGKETKDQQPAPPPEIVLKVFMHCEGCARKV 74 >XP_019457664.1 PREDICTED: heavy metal-associated isoprenylated plant protein 7-like [Lupinus angustifolius] OIW18282.1 hypothetical protein TanjilG_31422 [Lupinus angustifolius] Length = 333 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 243 KDQPAPPPEIVLKVFMHCEGCARKV 317 KDQPA PPEIVLKVFMHCEGCARKV Sbjct: 55 KDQPAVPPEIVLKVFMHCEGCARKV 79 >XP_010037390.1 PREDICTED: heavy metal-associated isoprenylated plant protein 3-like [Eucalyptus grandis] Length = 348 Score = 53.1 bits (126), Expect = 6e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +3 Query: 243 KDQPAPPPEIVLKVFMHCEGCARKV 317 KD P PPPEIVLKV+MHCEGCARKV Sbjct: 43 KDPPPPPPEIVLKVYMHCEGCARKV 67