BLASTX nr result
ID: Glycyrrhiza31_contig00017286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017286 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP66179.1 putative alpha,alpha-trehalose-phosphate synthase [UD... 93 1e-19 XP_006573047.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 90 1e-18 XP_014523359.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 86 2e-17 XP_007157471.1 hypothetical protein PHAVU_002G072400g [Phaseolus... 85 7e-17 XP_003519705.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 85 7e-17 XP_017427407.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 83 3e-16 BAT99549.1 hypothetical protein VIGAN_10100100 [Vigna angularis ... 83 3e-16 KOM45669.1 hypothetical protein LR48_Vigan06g097500 [Vigna angul... 83 3e-16 XP_016190400.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 76 7e-14 XP_017408688.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 75 1e-13 XP_017408687.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 75 1e-13 XP_016202489.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 74 4e-13 XP_015957054.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 74 4e-13 XP_019421262.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 74 6e-13 XP_014523607.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 73 8e-13 XP_015965010.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 73 8e-13 KYP48802.1 putative alpha,alpha-trehalose-phosphate synthase [UD... 73 8e-13 XP_007153644.1 hypothetical protein PHAVU_003G053000g [Phaseolus... 72 2e-12 XP_019423661.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 72 2e-12 ACJ86290.1 unknown, partial [Medicago truncatula] 69 4e-12 >KYP66179.1 putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Cajanus cajan] Length = 860 Score = 92.8 bits (229), Expect = 1e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA GLLDIPHTPR IPRIMTVPGVISDLDVCGRYDG Sbjct: 1 MASRSYANLLDLAGGLLDIPHTPRTIPRIMTVPGVISDLDVCGRYDG 47 >XP_006573047.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] XP_014626519.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] KHN12097.1 Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine soja] KRH74621.1 hypothetical protein GLYMA_01G031900 [Glycine max] Length = 860 Score = 90.1 bits (222), Expect = 1e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ NLLDLA GLLDIPHTP+ IPRIMTVPGVISDLDVCGRYDG Sbjct: 1 MASRSYVNLLDLAGGLLDIPHTPKTIPRIMTVPGVISDLDVCGRYDG 47 >XP_014523359.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Vigna radiata var. radiata] XP_014523360.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Vigna radiata var. radiata] XP_014523361.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Vigna radiata var. radiata] Length = 860 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA GLLDIPH+PR+IPRIMTVPGVISDLD GRYDG Sbjct: 1 MASRSYANLLDLAGGLLDIPHSPRSIPRIMTVPGVISDLDASGRYDG 47 >XP_007157471.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] XP_007157472.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] ESW29465.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] ESW29466.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] Length = 860 Score = 84.7 bits (208), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA LLDIPHTPR IPRIMTVPGVISDLD GRYDG Sbjct: 1 MASRSYANLLDLAGDLLDIPHTPRTIPRIMTVPGVISDLDASGRYDG 47 >XP_003519705.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] XP_014620140.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] KHN00343.1 Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine soja] KRH69529.1 hypothetical protein GLYMA_02G033500 [Glycine max] KRH69530.1 hypothetical protein GLYMA_02G033500 [Glycine max] Length = 860 Score = 84.7 bits (208), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ NLLDLA GLLDIPH PR IPRIMTVPGVISDLDV GRYDG Sbjct: 1 MASRSYVNLLDLAGGLLDIPHMPRTIPRIMTVPGVISDLDVYGRYDG 47 >XP_017427407.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Vigna angularis] XP_017427408.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Vigna angularis] XP_017427409.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Vigna angularis] Length = 860 Score = 83.2 bits (204), Expect = 3e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA GLLDIPH+ R+IPRIMTVPGVISDLD GRYDG Sbjct: 1 MASRSYANLLDLAGGLLDIPHSQRSIPRIMTVPGVISDLDASGRYDG 47 >BAT99549.1 hypothetical protein VIGAN_10100100 [Vigna angularis var. angularis] Length = 881 Score = 83.2 bits (204), Expect = 3e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA GLLDIPH+ R+IPRIMTVPGVISDLD GRYDG Sbjct: 1 MASRSYANLLDLAGGLLDIPHSQRSIPRIMTVPGVISDLDASGRYDG 47 >KOM45669.1 hypothetical protein LR48_Vigan06g097500 [Vigna angularis] Length = 1109 Score = 83.2 bits (204), Expect = 3e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA GLLDIPH+ R+IPRIMTVPGVISDLD GRYDG Sbjct: 1 MASRSYANLLDLAGGLLDIPHSQRSIPRIMTVPGVISDLDASGRYDG 47 >XP_016190400.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] XP_016190401.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] XP_016190402.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] Length = 862 Score = 76.3 bits (186), Expect = 7e-14 Identities = 38/49 (77%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -2 Query: 143 MASRSFANLLDLAEG--LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANL DLA G LLDIP TPRA+PRIMTVPG+ISDLD CG DG Sbjct: 1 MASRSYANLFDLASGGDLLDIPRTPRALPRIMTVPGIISDLDSCGANDG 49 >XP_017408688.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 isoform X2 [Vigna angularis] KOM28278.1 hypothetical protein LR48_Vigan511s010100 [Vigna angularis] Length = 858 Score = 75.5 bits (184), Expect = 1e-13 Identities = 38/48 (79%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MASRSFANLLDLAEG-LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA G LLDIPHTPRA+PR+MTVPG+ISDLD G DG Sbjct: 1 MASRSYANLLDLANGDLLDIPHTPRALPRVMTVPGIISDLDGYGCNDG 48 >XP_017408687.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 isoform X1 [Vigna angularis] BAT74658.1 hypothetical protein VIGAN_01237000 [Vigna angularis var. angularis] Length = 873 Score = 75.5 bits (184), Expect = 1e-13 Identities = 38/48 (79%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MASRSFANLLDLAEG-LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA G LLDIPHTPRA+PR+MTVPG+ISDLD G DG Sbjct: 16 MASRSYANLLDLANGDLLDIPHTPRALPRVMTVPGIISDLDGYGCNDG 63 >XP_016202489.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] XP_016202490.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] Length = 860 Score = 73.9 bits (180), Expect = 4e-13 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYD 6 M SRS+ NLLDLA LL IP+TPR IPR+MTVPGVISDLD CGR D Sbjct: 1 MVSRSYVNLLDLAGDLLGIPNTPRTIPRVMTVPGVISDLDACGRND 46 >XP_015957054.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] XP_015957055.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] XP_015957056.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] Length = 862 Score = 73.9 bits (180), Expect = 4e-13 Identities = 37/49 (75%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -2 Query: 143 MASRSFANLLDLAEG--LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANL DL G LLDIP TPRA+PRIMTVPG+ISDLD CG DG Sbjct: 1 MASRSYANLFDLVSGGDLLDIPGTPRALPRIMTVPGIISDLDSCGANDG 49 >XP_019421262.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Lupinus angustifolius] OIV94520.1 hypothetical protein TanjilG_25582 [Lupinus angustifolius] Length = 862 Score = 73.6 bits (179), Expect = 6e-13 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYD 6 MASRSFANLLDL L DIPHTPR +PR+MT PG+ISDLDV GR D Sbjct: 1 MASRSFANLLDLLGDLPDIPHTPRTLPRVMTAPGIISDLDVYGRND 46 >XP_014523607.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Vigna radiata var. radiata] Length = 858 Score = 73.2 bits (178), Expect = 8e-13 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MASRSFANLLDLAEG-LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA G LLDIPHTPRA+PR+MTVPG+ISDLD DG Sbjct: 1 MASRSYANLLDLANGDLLDIPHTPRALPRVMTVPGIISDLDGYSCNDG 48 >XP_015965010.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] XP_015965011.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] Length = 860 Score = 73.2 bits (178), Expect = 8e-13 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -2 Query: 143 MASRSFANLLDLAEGLLDIPHTPRAIPRIMTVPGVISDLDVCGRYD 6 M SRS+ NLLDLA LL IP+TPR +PR+MTVPGVISDLD CGR D Sbjct: 1 MVSRSYVNLLDLAGDLLGIPNTPRTLPRVMTVPGVISDLDACGRND 46 >KYP48802.1 putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Cajanus cajan] Length = 861 Score = 73.2 bits (178), Expect = 8e-13 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MASRSFANLLDLAEG-LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA G LLDIPHTPRA+PR+MTVPG+ISDLD DG Sbjct: 1 MASRSYANLLDLASGDLLDIPHTPRALPRVMTVPGIISDLDGYSCNDG 48 >XP_007153644.1 hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris] ESW25638.1 hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris] Length = 857 Score = 72.0 bits (175), Expect = 2e-12 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MASRSFANLLDLAEG-LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 MASRS+ANLLDLA G LLDIP TPRA+PR+MT+PG+ISDLD G DG Sbjct: 1 MASRSYANLLDLASGDLLDIPRTPRALPRVMTIPGIISDLDGYGCNDG 48 >XP_019423661.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Lupinus angustifolius] XP_019423662.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Lupinus angustifolius] OIV93734.1 hypothetical protein TanjilG_16585 [Lupinus angustifolius] Length = 862 Score = 72.0 bits (175), Expect = 2e-12 Identities = 37/49 (75%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -2 Query: 143 MASRSFANLLDLAEG--LLDIPHTPRAIPRIMTVPGVISDLDVCGRYDG 3 M+SRS+ANLLDLA G LLDIPHTPR +PRIMTVPG+ISDLD G DG Sbjct: 1 MSSRSYANLLDLAGGGGLLDIPHTPRTLPRIMTVPGIISDLDGYGCNDG 49 >ACJ86290.1 unknown, partial [Medicago truncatula] Length = 170 Score = 68.6 bits (166), Expect = 4e-12 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -2 Query: 143 MASRSFANLLDLAEG-LLDIPHTPRAIPRIMTVPGVISDLD 24 M SRS+ANLLDLA G LLDIPHTPR +PR+MTVPG+ISDLD Sbjct: 1 MTSRSYANLLDLAGGDLLDIPHTPRGLPRVMTVPGIISDLD 41