BLASTX nr result
ID: Glycyrrhiza31_contig00017216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017216 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014631268.1 PREDICTED: ethylene-responsive transcription fact... 62 1e-08 XP_003630161.1 DNA-binding domain protein [Medicago truncatula] ... 55 5e-06 >XP_014631268.1 PREDICTED: ethylene-responsive transcription factor ABR1-like [Glycine max] KHN34033.1 Ethylene-responsive transcription factor ERF114 [Glycine soja] KRH59504.1 hypothetical protein GLYMA_05G186700 [Glycine max] Length = 345 Score = 62.4 bits (150), Expect = 1e-08 Identities = 35/65 (53%), Positives = 44/65 (67%) Frame = -1 Query: 246 NFGENQGNGVDHCSDLNEERNTYTQHNIPTLSMPLMMFPEGLNREREMSAMISALTHVIC 67 N + +GN VD +Y QH+ TLSMP+M GLNRE+EMSAMISALTHV+C Sbjct: 4 NRDKEKGNDVDQ---------SYRQHH--TLSMPMMF--SGLNREKEMSAMISALTHVVC 50 Query: 66 GEEKH 52 GE++H Sbjct: 51 GEDEH 55 >XP_003630161.1 DNA-binding domain protein [Medicago truncatula] AET04637.1 DNA-binding domain protein [Medicago truncatula] Length = 313 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/38 (73%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -1 Query: 150 MPL-MMFPEGLNREREMSAMISALTHVICGEEKHDDGA 40 MPL MMFP GLNRE EMSAM+SALTHVICG++ +D G+ Sbjct: 1 MPLPMMFP-GLNREGEMSAMVSALTHVICGDQNNDGGS 37