BLASTX nr result
ID: Glycyrrhiza31_contig00017039
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017039 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003544919.1 PREDICTED: protein TIC110, chloroplastic-like [Gl... 67 1e-10 KHN46101.1 Protein TIC110-like protein, chloroplastic [Glycine s... 66 4e-10 XP_003519280.1 PREDICTED: protein TIC110, chloroplastic-like [Gl... 66 5e-10 KYP72957.1 hypothetical protein KK1_005562 [Cajanus cajan] 63 4e-09 GAU36244.1 hypothetical protein TSUD_214410 [Trifolium subterran... 63 5e-09 XP_007142070.1 hypothetical protein PHAVU_008G250000g [Phaseolus... 62 7e-09 AHA84146.1 chloroplast inner envelope protein, partial [Phaseolu... 59 9e-09 XP_019432221.1 PREDICTED: protein TIC110, chloroplastic-like [Lu... 62 1e-08 XP_010087175.1 hypothetical protein L484_002222 [Morus notabilis... 62 1e-08 OIW16091.1 hypothetical protein TanjilG_18806 [Lupinus angustifo... 62 1e-08 XP_004500340.1 PREDICTED: protein TIC110, chloroplastic-like [Ci... 61 2e-08 XP_017430204.1 PREDICTED: protein TIC110, chloroplastic [Vigna a... 60 3e-08 XP_014504734.1 PREDICTED: protein TIC110, chloroplastic [Vigna r... 60 3e-08 XP_015874705.1 PREDICTED: protein TIC110, chloroplastic, partial... 60 4e-08 XP_004490697.1 PREDICTED: protein TIC110, chloroplastic [Cicer a... 60 5e-08 XP_008225261.1 PREDICTED: protein TIC110, chloroplastic-like [Pr... 58 6e-08 XP_019461129.1 PREDICTED: protein TIC110, chloroplastic-like [Lu... 59 9e-08 XP_014625806.1 PREDICTED: protein TIC110, chloroplastic-like iso... 58 2e-07 XP_003551181.1 PREDICTED: protein TIC110, chloroplastic-like iso... 58 2e-07 XP_008229850.1 PREDICTED: protein TIC110, chloroplastic [Prunus ... 58 3e-07 >XP_003544919.1 PREDICTED: protein TIC110, chloroplastic-like [Glycine max] KRH17141.1 hypothetical protein GLYMA_14G201500 [Glycine max] Length = 996 Score = 67.4 bits (163), Expect = 1e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+LREMGDRLLN T EEEKFVF Sbjct: 960 LSRLQYLLGINDSTAAALREMGDRLLNTTAEEEKFVF 996 >KHN46101.1 Protein TIC110-like protein, chloroplastic [Glycine soja] Length = 781 Score = 65.9 bits (159), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+LRE+GDRLLN T EEEKFVF Sbjct: 745 LSRLQYLLGINDSTAAALREIGDRLLNTTAEEEKFVF 781 >XP_003519280.1 PREDICTED: protein TIC110, chloroplastic-like [Glycine max] KRH72787.1 hypothetical protein GLYMA_02G233700 [Glycine max] Length = 995 Score = 65.9 bits (159), Expect = 5e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+LRE+GDRLLN T EEEKFVF Sbjct: 959 LSRLQYLLGINDSTAAALREIGDRLLNTTAEEEKFVF 995 >KYP72957.1 hypothetical protein KK1_005562 [Cajanus cajan] Length = 1000 Score = 63.2 bits (152), Expect = 4e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+LRE GDRLL+ T EEEKFVF Sbjct: 964 LSRLQYLLGINDSTAAALRERGDRLLDATAEEEKFVF 1000 >GAU36244.1 hypothetical protein TSUD_214410 [Trifolium subterraneum] Length = 913 Score = 62.8 bits (151), Expect = 5e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 LNRLQYLLGINDSTAA+LRE GDRLLN T EEEKFVF Sbjct: 878 LNRLQYLLGINDSTAAALRESGDRLLN-TAEEEKFVF 913 >XP_007142070.1 hypothetical protein PHAVU_008G250000g [Phaseolus vulgaris] ESW14064.1 hypothetical protein PHAVU_008G250000g [Phaseolus vulgaris] Length = 996 Score = 62.4 bits (150), Expect = 7e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+L EMGDRLLN T EEE FVF Sbjct: 960 LSRLQYLLGINDSTAAALGEMGDRLLNSTAEEENFVF 996 >AHA84146.1 chloroplast inner envelope protein, partial [Phaseolus vulgaris] Length = 99 Score = 58.5 bits (140), Expect = 9e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQ+LLGINDST A+ EMGDRLLN T EEE FVF Sbjct: 63 LSRLQFLLGINDSTGAAFGEMGDRLLNFTAEEENFVF 99 >XP_019432221.1 PREDICTED: protein TIC110, chloroplastic-like [Lupinus angustifolius] Length = 1001 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTA++LRE GDRLLN T EEE+FVF Sbjct: 965 LSRLQYLLGINDSTASALRERGDRLLNNTAEEEEFVF 1001 >XP_010087175.1 hypothetical protein L484_002222 [Morus notabilis] EXB28414.1 hypothetical protein L484_002222 [Morus notabilis] Length = 1018 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGI+DSTAA+LREMGDR+L+I EEEKFVF Sbjct: 982 LSRLQYLLGISDSTAAALREMGDRVLSIGAEEEKFVF 1018 >OIW16091.1 hypothetical protein TanjilG_18806 [Lupinus angustifolius] Length = 1055 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTA++LRE GDRLLN T EEE+FVF Sbjct: 1019 LSRLQYLLGINDSTASALRERGDRLLNNTAEEEEFVF 1055 >XP_004500340.1 PREDICTED: protein TIC110, chloroplastic-like [Cicer arietinum] Length = 994 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L R+QYLLGINDSTAA+LREMGDRL+N EEE+FVF Sbjct: 958 LTRMQYLLGINDSTAAALREMGDRLINSAVEEEEFVF 994 >XP_017430204.1 PREDICTED: protein TIC110, chloroplastic [Vigna angularis] KOM47188.1 hypothetical protein LR48_Vigan07g089200 [Vigna angularis] BAT81395.1 hypothetical protein VIGAN_03110600 [Vigna angularis var. angularis] Length = 994 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA++ +MGDRLLN T EEE FVF Sbjct: 958 LSRLQYLLGINDSTAAAIGQMGDRLLNSTAEEENFVF 994 >XP_014504734.1 PREDICTED: protein TIC110, chloroplastic [Vigna radiata var. radiata] Length = 996 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA++ +MGDRLLN T EEE FVF Sbjct: 960 LSRLQYLLGINDSTAAAIGQMGDRLLNSTAEEENFVF 996 >XP_015874705.1 PREDICTED: protein TIC110, chloroplastic, partial [Ziziphus jujuba] Length = 446 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+LREMGD++L + EEEKFVF Sbjct: 410 LSRLQYLLGINDSTAAALREMGDKVLTGSAEEEKFVF 446 >XP_004490697.1 PREDICTED: protein TIC110, chloroplastic [Cicer arietinum] Length = 992 Score = 60.1 bits (144), Expect = 5e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGIND+TAA+L++ GDRLL+IT +EEKFVF Sbjct: 956 LSRLQYLLGINDTTAAALQDSGDRLLDITADEEKFVF 992 >XP_008225261.1 PREDICTED: protein TIC110, chloroplastic-like [Prunus mume] Length = 157 Score = 57.8 bits (138), Expect = 6e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLL INDSTAASLREMGDRL I EEE FVF Sbjct: 121 LSRLQYLLDINDSTAASLREMGDRLQPIGAEEENFVF 157 >XP_019461129.1 PREDICTED: protein TIC110, chloroplastic-like [Lupinus angustifolius] OIW02601.1 hypothetical protein TanjilG_24052 [Lupinus angustifolius] Length = 998 Score = 59.3 bits (142), Expect = 9e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAA+LRE GDRLLN T EEE+FVF Sbjct: 963 LSRLQYLLGINDSTAAALRERGDRLLN-TAEEEEFVF 998 >XP_014625806.1 PREDICTED: protein TIC110, chloroplastic-like isoform X2 [Glycine max] Length = 987 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAASLREMG+RLL+ E E+FVF Sbjct: 951 LSRLQYLLGINDSTAASLREMGERLLSNNAEVEEFVF 987 >XP_003551181.1 PREDICTED: protein TIC110, chloroplastic-like isoform X1 [Glycine max] KRG98182.1 hypothetical protein GLYMA_18G055700 [Glycine max] Length = 990 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLLGINDSTAASLREMG+RLL+ E E+FVF Sbjct: 954 LSRLQYLLGINDSTAASLREMGERLLSNNAEVEEFVF 990 >XP_008229850.1 PREDICTED: protein TIC110, chloroplastic [Prunus mume] Length = 1005 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 372 LNRLQYLLGINDSTAASLREMGDRLLNITEEEEKFVF 262 L+RLQYLL INDSTAASLREMGDRL I EEE FVF Sbjct: 969 LSRLQYLLDINDSTAASLREMGDRLQPIGAEEENFVF 1005