BLASTX nr result
ID: Glycyrrhiza31_contig00017021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00017021 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489223.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 3e-31 GAU16197.1 hypothetical protein TSUD_298290 [Trifolium subterran... 123 8e-31 XP_007163936.1 hypothetical protein PHAVU_L0043000g, partial [Ph... 116 4e-30 XP_019447802.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 5e-30 KHN27457.1 Pentatricopeptide repeat-containing protein [Glycine ... 117 6e-29 XP_003525674.1 PREDICTED: pentatricopeptide repeat-containing pr... 117 2e-28 ACZ74655.1 hypothetical protein [Phaseolus vulgaris] ACZ74661.1 ... 116 3e-28 XP_003618141.2 PPR containing plant-like protein [Medicago trunc... 116 4e-28 KYP54840.1 Pentatricopeptide repeat-containing protein At5g40400... 115 5e-28 XP_007153224.1 hypothetical protein PHAVU_003G017200g [Phaseolus... 116 6e-28 XP_016183090.1 PREDICTED: pentatricopeptide repeat-containing pr... 115 1e-27 XP_015948635.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-26 XP_017438853.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 6e-25 XP_014490391.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 5e-24 OMO69373.1 hypothetical protein COLO4_29095 [Corchorus olitorius] 85 7e-17 XP_006470265.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 3e-16 XP_015879293.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 2e-15 XP_015879291.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 2e-15 XP_006446568.1 hypothetical protein CICLE_v10018361mg, partial [... 81 2e-15 KDO55175.1 hypothetical protein CISIN_1g037911mg, partial [Citru... 81 2e-15 >XP_004489223.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Cicer arietinum] XP_004489224.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Cicer arietinum] Length = 622 Score = 125 bits (314), Expect = 3e-31 Identities = 60/77 (77%), Positives = 70/77 (90%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFAKEFQV DTVSYNA+ K F EVGNVAELMELQD+L+K+GYVPN+LTCK+VIR LQ Sbjct: 546 LLKFFAKEFQVYDTVSYNAIFKVFCEVGNVAELMELQDKLVKIGYVPNSLTCKYVIRGLQ 605 Query: 159 KDMELDDEILSHNMLEV 109 KD+ELDD+IL ++LEV Sbjct: 606 KDLELDDDILDRDLLEV 622 >GAU16197.1 hypothetical protein TSUD_298290 [Trifolium subterraneum] Length = 485 Score = 123 bits (308), Expect = 8e-31 Identities = 59/77 (76%), Positives = 69/77 (89%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFAKEFQV DT SYN++VK F EVGNVAELMELQD+L K+G+VPN+LTCK+VI+ LQ Sbjct: 409 LLKFFAKEFQVYDTESYNSIVKVFCEVGNVAELMELQDKLAKIGFVPNSLTCKYVIQGLQ 468 Query: 159 KDMELDDEILSHNMLEV 109 KDMELDD++L NMLEV Sbjct: 469 KDMELDDDMLDRNMLEV 485 >XP_007163936.1 hypothetical protein PHAVU_L0043000g, partial [Phaseolus vulgaris] ESW35930.1 hypothetical protein PHAVU_L0043000g, partial [Phaseolus vulgaris] Length = 229 Score = 116 bits (290), Expect = 4e-30 Identities = 56/74 (75%), Positives = 64/74 (86%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLK FAKEFQV DT SYNAVVK F +VGNV ELME++D+LLKVGYVPN LTC+HVI LQ Sbjct: 155 LLKLFAKEFQVYDTESYNAVVKVFCDVGNVTELMEVEDKLLKVGYVPNKLTCRHVIHGLQ 214 Query: 159 KDMELDDEILSHNM 118 K MELDDEIL+H++ Sbjct: 215 KAMELDDEILNHSL 228 >XP_019447802.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Lupinus angustifolius] OIW09118.1 hypothetical protein TanjilG_11256 [Lupinus angustifolius] Length = 627 Score = 122 bits (305), Expect = 5e-30 Identities = 62/77 (80%), Positives = 67/77 (87%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFAK F+V DT SYNAVVK E+GNVAELMELQD+LLKVGYVPN+LTCK+VIR LQ Sbjct: 551 LLKFFAKVFKVHDTESYNAVVKVSCEIGNVAELMELQDKLLKVGYVPNSLTCKYVIRGLQ 610 Query: 159 KDMELDDEILSHNMLEV 109 K MELDDEI HNMLEV Sbjct: 611 KAMELDDEISGHNMLEV 627 >KHN27457.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 434 Score = 117 bits (293), Expect = 6e-29 Identities = 59/77 (76%), Positives = 65/77 (84%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFA EFQV DT SYNAVVK F +VGNVAEL+ELQD+LLKVGYV N LTCK+VI LQ Sbjct: 358 LLKFFANEFQVYDTESYNAVVKVFCDVGNVAELLELQDKLLKVGYVSNRLTCKYVIHGLQ 417 Query: 159 KDMELDDEILSHNMLEV 109 K ME DDE+L H+MLEV Sbjct: 418 KAMEQDDEMLGHDMLEV 434 >XP_003525674.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Glycine max] XP_006579777.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Glycine max] XP_006579778.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Glycine max] XP_006579779.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Glycine max] XP_014630863.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Glycine max] KRH56553.1 hypothetical protein GLYMA_05G004200 [Glycine max] Length = 626 Score = 117 bits (293), Expect = 2e-28 Identities = 59/77 (76%), Positives = 65/77 (84%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFA EFQV DT SYNAVVK F +VGNVAEL+ELQD+LLKVGYV N LTCK+VI LQ Sbjct: 550 LLKFFANEFQVYDTESYNAVVKVFCDVGNVAELLELQDKLLKVGYVSNRLTCKYVIHGLQ 609 Query: 159 KDMELDDEILSHNMLEV 109 K ME DDE+L H+MLEV Sbjct: 610 KAMEQDDEMLGHDMLEV 626 >ACZ74655.1 hypothetical protein [Phaseolus vulgaris] ACZ74661.1 hypothetical protein [Phaseolus vulgaris] Length = 485 Score = 116 bits (290), Expect = 3e-28 Identities = 56/74 (75%), Positives = 64/74 (86%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLK FAKEFQV DT SYNAVVK F +VGNV ELME++D+LLKVGYVPN LTC+HVI LQ Sbjct: 411 LLKLFAKEFQVYDTESYNAVVKVFCDVGNVTELMEVEDKLLKVGYVPNKLTCRHVIHGLQ 470 Query: 159 KDMELDDEILSHNM 118 K MELDDEIL+H++ Sbjct: 471 KAMELDDEILNHSL 484 >XP_003618141.2 PPR containing plant-like protein [Medicago truncatula] AES74359.2 PPR containing plant-like protein [Medicago truncatula] Length = 645 Score = 116 bits (291), Expect = 4e-28 Identities = 60/79 (75%), Positives = 68/79 (86%), Gaps = 2/79 (2%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFAKEFQV DT SYNA+VK F EVGNVAELMELQD+L+K+GYVPN+LTCK+VIR LQ Sbjct: 567 LLKFFAKEFQVYDTESYNAIVKVFCEVGNVAELMELQDKLVKIGYVPNSLTCKYVIRGLQ 626 Query: 159 KDMEL--DDEILSHNMLEV 109 K MEL DD+I +MLEV Sbjct: 627 KGMELDDDDDISDGDMLEV 645 >KYP54840.1 Pentatricopeptide repeat-containing protein At5g40400 family [Cajanus cajan] Length = 486 Score = 115 bits (288), Expect = 5e-28 Identities = 58/78 (74%), Positives = 66/78 (84%), Gaps = 1/78 (1%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLK FAKEF++ DT SYNA+VK F EVGN+ ELMELQD+LLKVGYVPN LTCK+VI LQ Sbjct: 409 LLKIFAKEFKIYDTESYNAIVKVFCEVGNIDELMELQDKLLKVGYVPNKLTCKYVIHGLQ 468 Query: 159 KDMEL-DDEILSHNMLEV 109 K MEL DDE+L HNML+V Sbjct: 469 KAMELDDDEMLGHNMLKV 486 >XP_007153224.1 hypothetical protein PHAVU_003G017200g [Phaseolus vulgaris] ESW25218.1 hypothetical protein PHAVU_003G017200g [Phaseolus vulgaris] Length = 631 Score = 116 bits (290), Expect = 6e-28 Identities = 56/74 (75%), Positives = 64/74 (86%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLK FAKEFQV DT SYNAVVK F +VGNV ELME++D+LLKVGYVPN LTC+HVI LQ Sbjct: 557 LLKLFAKEFQVYDTESYNAVVKVFCDVGNVTELMEVEDKLLKVGYVPNKLTCRHVIHGLQ 616 Query: 159 KDMELDDEILSHNM 118 K MELDDEIL+H++ Sbjct: 617 KAMELDDEILNHSL 630 >XP_016183090.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183091.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183092.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183093.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183094.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183095.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183096.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] XP_016183098.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis ipaensis] Length = 657 Score = 115 bits (287), Expect = 1e-27 Identities = 59/76 (77%), Positives = 63/76 (82%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LL FAKEFQV DT SYNAVVK F E GNVAELMELQDRLLKVGYVPN+LTCK+VI+ LQ Sbjct: 581 LLNLFAKEFQVYDTESYNAVVKVFCEDGNVAELMELQDRLLKVGYVPNSLTCKYVIQGLQ 640 Query: 159 KDMELDDEILSHNMLE 112 K M LDDE+L MLE Sbjct: 641 KTMVLDDELLDQTMLE 656 >XP_015948635.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis duranensis] XP_015948636.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis duranensis] XP_015948637.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis duranensis] XP_015948638.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis duranensis] XP_015948640.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Arachis duranensis] Length = 648 Score = 111 bits (278), Expect = 2e-26 Identities = 57/76 (75%), Positives = 63/76 (82%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LL FAKEF+V DT SYNAVVK F E GNVAELMELQDRLLKVGYVPN+LTCK+VI+ LQ Sbjct: 572 LLNLFAKEFRVYDTKSYNAVVKVFCEDGNVAELMELQDRLLKVGYVPNSLTCKYVIQGLQ 631 Query: 159 KDMELDDEILSHNMLE 112 K M LD+E+L MLE Sbjct: 632 KTMVLDNELLDQTMLE 647 >XP_017438853.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vigna angularis] KOM56929.1 hypothetical protein LR48_Vigan10g282100 [Vigna angularis] BAU00971.1 hypothetical protein VIGAN_11011700 [Vigna angularis var. angularis] Length = 633 Score = 107 bits (268), Expect = 6e-25 Identities = 53/70 (75%), Positives = 59/70 (84%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLK FAKEFQV D SYNAVVK F +VGNV ELME+QD+LLKVGYVPN LTC++VI LQ Sbjct: 563 LLKLFAKEFQVYDNESYNAVVKVFCDVGNVTELMEIQDKLLKVGYVPNKLTCRYVIHGLQ 622 Query: 159 KDMELDDEIL 130 K ME+DDEIL Sbjct: 623 KAMEVDDEIL 632 >XP_014490391.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Vigna radiata var. radiata] Length = 640 Score = 105 bits (261), Expect = 5e-24 Identities = 52/70 (74%), Positives = 58/70 (82%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLK FAKEFQV D SYNAVVK F +VGNV ELME+QD+LLKVGYVPN LTC++VI LQ Sbjct: 570 LLKLFAKEFQVYDNESYNAVVKVFCDVGNVTELMEIQDKLLKVGYVPNKLTCRYVIHGLQ 629 Query: 159 KDMELDDEIL 130 K ME+D EIL Sbjct: 630 KAMEVDHEIL 639 >OMO69373.1 hypothetical protein COLO4_29095 [Corchorus olitorius] Length = 625 Score = 84.7 bits (208), Expect = 7e-17 Identities = 41/70 (58%), Positives = 52/70 (74%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LLKFFAKEFQ+ DT SYN +V +E G+V +LMELQDR+LKVG+ PN+LTCKH+I L Sbjct: 553 LLKFFAKEFQIFDTESYNFLVSTLTEDGDVNKLMELQDRMLKVGFAPNSLTCKHIIHGLV 612 Query: 159 KDMELDDEIL 130 L+ + L Sbjct: 613 NATRLEKQKL 622 >XP_006470265.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Citrus sinensis] XP_006470266.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Citrus sinensis] Length = 621 Score = 82.8 bits (203), Expect = 3e-16 Identities = 39/64 (60%), Positives = 51/64 (79%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LL FFAK+FQ+ DT SYNAV F+E G++++LMELQ R L++G+ PNNLTCK++IR L Sbjct: 552 LLGFFAKKFQIYDTESYNAVFNMFAEDGDLSKLMELQKRFLRLGFAPNNLTCKYMIRSLW 611 Query: 159 KDME 148 K ME Sbjct: 612 KGME 615 >XP_015879293.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 isoform X3 [Ziziphus jujuba] Length = 565 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/65 (58%), Positives = 48/65 (73%) Frame = -2 Query: 336 LKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQK 157 L FA+EFQ+ DT SYN +VK E GNVA+++ELQDR+LKVG PN+LTC++VI L K Sbjct: 493 LSLFAREFQIFDTESYNILVKVLCEEGNVAKMLELQDRMLKVGLTPNSLTCRYVIHSLWK 552 Query: 156 DMELD 142 LD Sbjct: 553 TTNLD 557 >XP_015879291.1 PREDICTED: pentatricopeptide repeat-containing protein At5g40400 isoform X2 [Ziziphus jujuba] Length = 586 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/65 (58%), Positives = 48/65 (73%) Frame = -2 Query: 336 LKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQK 157 L FA+EFQ+ DT SYN +VK E GNVA+++ELQDR+LKVG PN+LTC++VI L K Sbjct: 514 LSLFAREFQIFDTESYNILVKVLCEEGNVAKMLELQDRMLKVGLTPNSLTCRYVIHSLWK 573 Query: 156 DMELD 142 LD Sbjct: 574 TTNLD 578 >XP_006446568.1 hypothetical protein CICLE_v10018361mg, partial [Citrus clementina] ESR59808.1 hypothetical protein CICLE_v10018361mg, partial [Citrus clementina] Length = 603 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/64 (59%), Positives = 50/64 (78%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LL FFAK+FQ+ DT SYNAV F+E G++++LMELQ R L++G+ PNNLTCK++I L Sbjct: 534 LLGFFAKKFQIYDTESYNAVFNMFAEDGDLSKLMELQKRFLRLGFAPNNLTCKYMIHSLW 593 Query: 159 KDME 148 K ME Sbjct: 594 KGME 597 >KDO55175.1 hypothetical protein CISIN_1g037911mg, partial [Citrus sinensis] Length = 609 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/64 (59%), Positives = 50/64 (78%) Frame = -2 Query: 339 LLKFFAKEFQVCDTVSYNAVVKAFSEVGNVAELMELQDRLLKVGYVPNNLTCKHVIRRLQ 160 LL FFAK+FQ+ DT SYNAV F+E G++++LMELQ R L++G+ PNNLTCK++I L Sbjct: 542 LLGFFAKKFQIYDTESYNAVFNMFAEDGDLSKLMELQKRFLRLGFAPNNLTCKYMIHSLW 601 Query: 159 KDME 148 K ME Sbjct: 602 KGME 605