BLASTX nr result
ID: Glycyrrhiza31_contig00016858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016858 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019435461.1 PREDICTED: septum-promoting GTP-binding protein 1... 102 1e-24 XP_019435455.1 PREDICTED: septum-promoting GTP-binding protein 1... 102 2e-24 XP_019435445.1 PREDICTED: septum-promoting GTP-binding protein 1... 102 2e-24 KHN38295.1 Septum-promoting GTP-binding protein 1 [Glycine soja]... 100 9e-24 XP_003519565.1 PREDICTED: septum-promoting GTP-binding protein 1... 100 2e-23 XP_003545017.1 PREDICTED: septum-promoting GTP-binding protein 1... 99 9e-23 XP_014622024.1 PREDICTED: septum-promoting GTP-binding protein 1... 99 1e-22 XP_017429172.1 PREDICTED: septum-promoting GTP-binding protein 1... 94 2e-21 XP_004491360.1 PREDICTED: septum-promoting GTP-binding protein 1... 94 4e-21 XP_014503821.1 PREDICTED: septum-promoting GTP-binding protein 1... 94 4e-21 XP_017429171.1 PREDICTED: septum-promoting GTP-binding protein 1... 94 5e-21 BAT80738.1 hypothetical protein VIGAN_03033700 [Vigna angularis ... 94 5e-21 XP_003617481.1 Ras-related small GTP-binding family protein [Med... 92 3e-20 XP_019459038.1 PREDICTED: septum-promoting GTP-binding protein 1... 86 4e-18 XP_019459037.1 PREDICTED: septum-promoting GTP-binding protein 1... 86 4e-18 XP_007142252.1 hypothetical protein PHAVU_008G265300g [Phaseolus... 86 4e-18 XP_018811126.1 PREDICTED: septum-promoting GTP-binding protein 1... 86 8e-18 XP_015898751.1 PREDICTED: septum-promoting GTP-binding protein 1... 83 5e-17 XP_016164049.1 PREDICTED: septum-promoting GTP-binding protein 1... 82 9e-17 XP_015973375.1 PREDICTED: uncharacterized protein LOC107496586 i... 80 6e-16 >XP_019435461.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X4 [Lupinus angustifolius] Length = 256 Score = 102 bits (255), Expect = 1e-24 Identities = 55/89 (61%), Positives = 63/89 (70%), Gaps = 3/89 (3%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKYXXXXX 263 K+IHETTRKMSQLCRK+V V+VRWGVLQR SFVG FFRFI RL++CSVG+PAKY Sbjct: 5 KIIHETTRKMSQLCRKVVHVNVRWGVLQRVSFVGHFFRFIWGRLVLCSVGKPAKYRRLPF 64 Query: 264 XXXXXXPAATVD---YDGFPTLTDSGGYD 341 PAATV+ T+ DS GYD Sbjct: 65 GDSSPFPAATVEERFMQEHSTVMDS-GYD 92 >XP_019435455.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X3 [Lupinus angustifolius] OIW16335.1 hypothetical protein TanjilG_19051 [Lupinus angustifolius] Length = 282 Score = 102 bits (255), Expect = 2e-24 Identities = 55/89 (61%), Positives = 63/89 (70%), Gaps = 3/89 (3%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKYXXXXX 263 K+IHETTRKMSQLCRK+V V+VRWGVLQR SFVG FFRFI RL++CSVG+PAKY Sbjct: 5 KIIHETTRKMSQLCRKVVHVNVRWGVLQRVSFVGHFFRFIWGRLVLCSVGKPAKYRRLPF 64 Query: 264 XXXXXXPAATVD---YDGFPTLTDSGGYD 341 PAATV+ T+ DS GYD Sbjct: 65 GDSSPFPAATVEERFMQEHSTVMDS-GYD 92 >XP_019435445.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X1 [Lupinus angustifolius] XP_019435452.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X2 [Lupinus angustifolius] Length = 284 Score = 102 bits (255), Expect = 2e-24 Identities = 55/89 (61%), Positives = 63/89 (70%), Gaps = 3/89 (3%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKYXXXXX 263 K+IHETTRKMSQLCRK+V V+VRWGVLQR SFVG FFRFI RL++CSVG+PAKY Sbjct: 5 KIIHETTRKMSQLCRKVVHVNVRWGVLQRVSFVGHFFRFIWGRLVLCSVGKPAKYRRLPF 64 Query: 264 XXXXXXPAATVD---YDGFPTLTDSGGYD 341 PAATV+ T+ DS GYD Sbjct: 65 GDSSPFPAATVEERFMQEHSTVMDS-GYD 92 >KHN38295.1 Septum-promoting GTP-binding protein 1 [Glycine soja] KRH73714.1 hypothetical protein GLYMA_02G289300 [Glycine max] KRH73715.1 hypothetical protein GLYMA_02G289300 [Glycine max] Length = 232 Score = 100 bits (248), Expect = 9e-24 Identities = 51/87 (58%), Positives = 62/87 (71%), Gaps = 1/87 (1%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKYXXXX 260 K+IH+TTRKMSQLC+KIV+VDVRWGVL+R SFVG FFRFI +RL+VCSV GRP++Y Sbjct: 4 KIIHDTTRKMSQLCQKIVKVDVRWGVLKRVSFVGHFFRFIWNRLLVCSVAGRPSQYRKLP 63 Query: 261 XXXXXXXPAATVDYDGFPTLTDSGGYD 341 P + D F T +GGYD Sbjct: 64 VRDPSSSPPSYADDVFFSATTTTGGYD 90 >XP_003519565.1 PREDICTED: septum-promoting GTP-binding protein 1 [Glycine max] KRH73713.1 hypothetical protein GLYMA_02G289300 [Glycine max] Length = 282 Score = 100 bits (248), Expect = 2e-23 Identities = 51/87 (58%), Positives = 62/87 (71%), Gaps = 1/87 (1%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKYXXXX 260 K+IH+TTRKMSQLC+KIV+VDVRWGVL+R SFVG FFRFI +RL+VCSV GRP++Y Sbjct: 4 KIIHDTTRKMSQLCQKIVKVDVRWGVLKRVSFVGHFFRFIWNRLLVCSVAGRPSQYRKLP 63 Query: 261 XXXXXXXPAATVDYDGFPTLTDSGGYD 341 P + D F T +GGYD Sbjct: 64 VRDPSSSPPSYADDVFFSATTTTGGYD 90 >XP_003545017.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X2 [Glycine max] KRH14441.1 hypothetical protein GLYMA_14G025700 [Glycine max] Length = 282 Score = 98.6 bits (244), Expect = 9e-23 Identities = 52/87 (59%), Positives = 60/87 (68%), Gaps = 1/87 (1%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKYXXXX 260 K+IH+TTRKMSQLC+KIVQVDVRWG L+R SFVG FFRFI +RL+VCSV G P+ Y Sbjct: 4 KIIHDTTRKMSQLCQKIVQVDVRWGFLKRVSFVGHFFRFIWNRLVVCSVAGSPSHYRKLP 63 Query: 261 XXXXXXXPAATVDYDGFPTLTDSGGYD 341 P ATVD T +GGYD Sbjct: 64 LRDPSSSPPATVDDVFSSAATTTGGYD 90 >XP_014622024.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X1 [Glycine max] Length = 291 Score = 98.6 bits (244), Expect = 1e-22 Identities = 52/87 (59%), Positives = 60/87 (68%), Gaps = 1/87 (1%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKYXXXX 260 K+IH+TTRKMSQLC+KIVQVDVRWG L+R SFVG FFRFI +RL+VCSV G P+ Y Sbjct: 4 KIIHDTTRKMSQLCQKIVQVDVRWGFLKRVSFVGHFFRFIWNRLVVCSVAGSPSHYRKLP 63 Query: 261 XXXXXXXPAATVDYDGFPTLTDSGGYD 341 P ATVD T +GGYD Sbjct: 64 LRDPSSSPPATVDDVFSSAATTTGGYD 90 >XP_017429172.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X2 [Vigna angularis] Length = 230 Score = 94.0 bits (232), Expect = 2e-21 Identities = 46/58 (79%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKY 248 MAK+IH TTRKMSQLCRK VQVDVRWGVL+R SFVGQFFRFI +R++VCSV GRP Y Sbjct: 2 MAKIIHRTTRKMSQLCRKFVQVDVRWGVLKRVSFVGQFFRFIWNRIIVCSVAGRPPHY 59 >XP_004491360.1 PREDICTED: septum-promoting GTP-binding protein 1 [Cicer arietinum] Length = 278 Score = 94.4 bits (233), Expect = 4e-21 Identities = 51/78 (65%), Positives = 57/78 (73%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKYXXX 257 MAKVI ETT+KMSQLCRKIVQVDVRWG++QR SFVG FFRF +R M+CSV RPA+Y Sbjct: 1 MAKVIKETTKKMSQLCRKIVQVDVRWGIVQRVSFVGHFFRFFWNRFMLCSVPRPAQY--- 57 Query: 258 XXXXXXXXPAATVDYDGF 311 A TVD DGF Sbjct: 58 -RRLNLHHSATTVD-DGF 73 >XP_014503821.1 PREDICTED: septum-promoting GTP-binding protein 1 [Vigna radiata var. radiata] Length = 281 Score = 94.4 bits (233), Expect = 4e-21 Identities = 46/58 (79%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKY 248 MAK+IH TTRKMSQLCRK VQVDVRWGVL+R SFVGQFFRFI +R++VCSV GRP Y Sbjct: 2 MAKIIHRTTRKMSQLCRKFVQVDVRWGVLKRVSFVGQFFRFIWNRILVCSVAGRPPHY 59 >XP_017429171.1 PREDICTED: septum-promoting GTP-binding protein 1 isoform X1 [Vigna angularis] KOM46497.1 hypothetical protein LR48_Vigan07g020100 [Vigna angularis] Length = 281 Score = 94.0 bits (232), Expect = 5e-21 Identities = 46/58 (79%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKY 248 MAK+IH TTRKMSQLCRK VQVDVRWGVL+R SFVGQFFRFI +R++VCSV GRP Y Sbjct: 2 MAKIIHRTTRKMSQLCRKFVQVDVRWGVLKRVSFVGQFFRFIWNRIIVCSVAGRPPHY 59 >BAT80738.1 hypothetical protein VIGAN_03033700 [Vigna angularis var. angularis] Length = 282 Score = 94.0 bits (232), Expect = 5e-21 Identities = 46/58 (79%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKY 248 MAK+IH TTRKMSQLCRK VQVDVRWGVL+R SFVGQFFRFI +R++VCSV GRP Y Sbjct: 2 MAKIIHRTTRKMSQLCRKFVQVDVRWGVLKRVSFVGQFFRFIWNRIIVCSVAGRPPHY 59 >XP_003617481.1 Ras-related small GTP-binding family protein [Medicago truncatula] AET00440.1 Ras-related small GTP-binding family protein [Medicago truncatula] Length = 289 Score = 92.0 bits (227), Expect = 3e-20 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 1/58 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGR-PAKY 248 MAKVI ETT+KM+QLCRKIVQVDV++G+LQR SFVGQFFRFI ++LMVCSVGR PA+Y Sbjct: 1 MAKVIQETTKKMTQLCRKIVQVDVKYGMLQRVSFVGQFFRFIWNKLMVCSVGRSPAQY 58 >XP_019459038.1 PREDICTED: septum-promoting GTP-binding protein 1-like isoform X2 [Lupinus angustifolius] Length = 273 Score = 86.3 bits (212), Expect = 4e-18 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKY 248 K+IHETT+KMSQLCRK+V WGVLQR SFVGQFFRFI DR +VCSVG+P KY Sbjct: 4 KIIHETTKKMSQLCRKVVH----WGVLQRVSFVGQFFRFIWDRFVVCSVGKPVKY 54 >XP_019459037.1 PREDICTED: septum-promoting GTP-binding protein 1-like isoform X1 [Lupinus angustifolius] Length = 275 Score = 86.3 bits (212), Expect = 4e-18 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = +3 Query: 84 KVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKY 248 K+IHETT+KMSQLCRK+V WGVLQR SFVGQFFRFI DR +VCSVG+P KY Sbjct: 4 KIIHETTKKMSQLCRKVVH----WGVLQRVSFVGQFFRFIWDRFVVCSVGKPVKY 54 >XP_007142252.1 hypothetical protein PHAVU_008G265300g [Phaseolus vulgaris] ESW14246.1 hypothetical protein PHAVU_008G265300g [Phaseolus vulgaris] Length = 279 Score = 86.3 bits (212), Expect = 4e-18 Identities = 50/89 (56%), Positives = 57/89 (64%), Gaps = 1/89 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSV-GRPAKYXX 254 MAK+IH+TTR MSQLCRK QV VRWGVL+R SFVG FFRFI +R++VCSV G P Y Sbjct: 1 MAKIIHQTTRNMSQLCRKFAQVHVRWGVLKRVSFVGHFFRFIWNRILVCSVAGSPPHYRK 60 Query: 255 XXXXXXXXXPAATVDYDGFPTLTDSGGYD 341 AT D D F T + GYD Sbjct: 61 LPLRDQSSSLLAT-DSDAFLAAT-TCGYD 87 >XP_018811126.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Juglans regia] Length = 281 Score = 85.5 bits (210), Expect = 8e-18 Identities = 43/89 (48%), Positives = 56/89 (62%), Gaps = 1/89 (1%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKYXXX 257 MAK +HE R MSQLCRK+V +++RW VLQR SF+ QFFRFI DR++VCS G+ ++Y Sbjct: 1 MAKFVHEAARNMSQLCRKVVHINIRWSVLQRVSFIRQFFRFIWDRILVCSTGKASQYRRL 60 Query: 258 XXXXXXXXPAATVDYDGFPTLTDS-GGYD 341 P A GF + S GGY+ Sbjct: 61 SRRGSFPPPEAIEAGLGFDESSMSCGGYE 89 >XP_015898751.1 PREDICTED: septum-promoting GTP-binding protein 1 [Ziziphus jujuba] Length = 246 Score = 82.8 bits (203), Expect = 5e-17 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 5/93 (5%) Frame = +3 Query: 78 MAKVIHETTRKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAKYXXX 257 MAK++HE+TR M+QLC+K+V +DVRW +++R S +G FF+FI DR++VCS GR ++Y Sbjct: 1 MAKILHESTRNMTQLCKKVVHLDVRWSIVERVSVIGHFFKFIWDRIVVCSTGRSSRY-RR 59 Query: 258 XXXXXXXXPAATVDYDGF----PTLTDSGG-YD 341 P V DG PT T GG YD Sbjct: 60 LQRRSSSSPLLEVAEDGTVSDEPTTTCGGGVYD 92 >XP_016164049.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Arachis ipaensis] Length = 256 Score = 82.4 bits (202), Expect = 9e-17 Identities = 46/84 (54%), Positives = 56/84 (66%), Gaps = 5/84 (5%) Frame = +3 Query: 105 RKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAK---YXXXXXXXXX 275 RKMSQLC++IV+VD+RWGVLQR SFVGQFF FI DRL+VCSVG+ +K Y Sbjct: 7 RKMSQLCKRIVEVDIRWGVLQRVSFVGQFFHFIWDRLLVCSVGKKSKSSRYTRLPLGDSS 66 Query: 276 XXPAATVDYD-GF-PTLTDSGGYD 341 A + D+D GF TL GY+ Sbjct: 67 LAVAVSDDHDQGFHHTLVSESGYE 90 >XP_015973375.1 PREDICTED: uncharacterized protein LOC107496586 isoform X2 [Arachis duranensis] Length = 248 Score = 80.1 bits (196), Expect = 6e-16 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +3 Query: 105 RKMSQLCRKIVQVDVRWGVLQRESFVGQFFRFI*DRLMVCSVGRPAK 245 RKMSQLC++IV+VD+RWGVLQR SFVGQFF FI DRL+VCSVG+ +K Sbjct: 7 RKMSQLCKRIVEVDIRWGVLQRVSFVGQFFHFIWDRLLVCSVGKKSK 53