BLASTX nr result
ID: Glycyrrhiza31_contig00016496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016496 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006573047.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 65 1e-09 XP_004509840.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 65 2e-09 XP_019423661.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 65 2e-09 XP_007153644.1 hypothetical protein PHAVU_003G053000g [Phaseolus... 64 4e-09 XP_017408688.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 64 5e-09 KYP66179.1 putative alpha,alpha-trehalose-phosphate synthase [UD... 64 5e-09 XP_016190400.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 64 5e-09 XP_015957054.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 64 5e-09 XP_017408687.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 64 5e-09 ACU17713.1 unknown [Glycine max] 61 6e-09 KYP48802.1 putative alpha,alpha-trehalose-phosphate synthase [UD... 62 2e-08 XP_019421262.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 62 2e-08 XP_014523607.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 62 2e-08 XP_007157471.1 hypothetical protein PHAVU_002G072400g [Phaseolus... 62 2e-08 XP_003519705.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 61 3e-08 KHN24134.1 Putative alpha,alpha-trehalose-phosphate synthase [UD... 61 5e-08 XP_003552011.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 61 5e-08 ACJ83824.1 unknown, partial [Medicago truncatula] 55 7e-08 XP_016202489.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 60 1e-07 XP_015965010.1 PREDICTED: probable alpha,alpha-trehalose-phospha... 60 1e-07 >XP_006573047.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] XP_014626519.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] KHN12097.1 Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine soja] KRH74621.1 hypothetical protein GLYMA_01G031900 [Glycine max] Length = 860 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+DP+DVMKLLQGL SS PKPRHLAQFQVSFESTV Sbjct: 825 LDDPADVMKLLQGLGASSKPKPRHLAQFQVSFESTV 860 >XP_004509840.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Cicer arietinum] Length = 860 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D +DV+KLLQGLA SSNPKPRHLAQFQVSFESTV Sbjct: 824 LDDTTDVVKLLQGLAASSNPKPRHLAQFQVSFESTV 859 >XP_019423661.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Lupinus angustifolius] XP_019423662.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Lupinus angustifolius] OIV93734.1 hypothetical protein TanjilG_16585 [Lupinus angustifolius] Length = 862 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D +DV+KLLQGLATSSNPKPRHLA FQVSFESTV Sbjct: 827 LDDTTDVIKLLQGLATSSNPKPRHLAHFQVSFESTV 862 >XP_007153644.1 hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris] ESW25638.1 hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris] Length = 857 Score = 63.9 bits (154), Expect = 4e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D SDV+KLLQGLA SSNPKPRHLA FQVSFESTV Sbjct: 822 LDDTSDVVKLLQGLAASSNPKPRHLAHFQVSFESTV 857 >XP_017408688.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 isoform X2 [Vigna angularis] KOM28278.1 hypothetical protein LR48_Vigan511s010100 [Vigna angularis] Length = 858 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D SDV+KLLQGLA SSNPKPRHLA FQVSFEST+ Sbjct: 823 LDDTSDVVKLLQGLAASSNPKPRHLAHFQVSFESTI 858 >KYP66179.1 putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Cajanus cajan] Length = 860 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+DP+DVMKLLQGL SS PKPRHL QFQVSFESTV Sbjct: 825 LDDPADVMKLLQGLGASSKPKPRHLPQFQVSFESTV 860 >XP_016190400.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] XP_016190401.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] XP_016190402.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] Length = 862 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D DV+KLLQGLA+SSNPKPRHLAQFQVSFEST+ Sbjct: 827 LDDTLDVVKLLQGLASSSNPKPRHLAQFQVSFESTI 862 >XP_015957054.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] XP_015957055.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] XP_015957056.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] Length = 862 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D DV+KLLQGLA+SSNPKPRHLAQFQVSFEST+ Sbjct: 827 LDDTLDVVKLLQGLASSSNPKPRHLAQFQVSFESTI 862 >XP_017408687.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 isoform X1 [Vigna angularis] BAT74658.1 hypothetical protein VIGAN_01237000 [Vigna angularis var. angularis] Length = 873 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D SDV+KLLQGLA SSNPKPRHLA FQVSFEST+ Sbjct: 838 LDDTSDVVKLLQGLAASSNPKPRHLAHFQVSFESTI 873 >ACU17713.1 unknown [Glycine max] Length = 173 Score = 61.2 bits (147), Expect = 6e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+DP+DV+KLLQGL SS PK RHLAQFQVSFESTV Sbjct: 138 LDDPADVLKLLQGLGASSKPKSRHLAQFQVSFESTV 173 >KYP48802.1 putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Cajanus cajan] Length = 861 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D +DV+KLLQG+A SSNPKPRHLA FQVSFESTV Sbjct: 826 LDDAADVVKLLQGIAASSNPKPRHLAHFQVSFESTV 861 >XP_019421262.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Lupinus angustifolius] OIV94520.1 hypothetical protein TanjilG_25582 [Lupinus angustifolius] Length = 862 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+DPSDV+KLLQ L SSNPKPRHLAQFQVSFES V Sbjct: 827 LDDPSDVLKLLQCLGASSNPKPRHLAQFQVSFESRV 862 >XP_014523607.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Vigna radiata var. radiata] Length = 858 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D SDV+KLLQGLA SS+PKPRHLA FQVSFEST+ Sbjct: 823 LDDTSDVVKLLQGLAASSDPKPRHLAHFQVSFESTI 858 >XP_007157471.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] XP_007157472.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] ESW29465.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] ESW29466.1 hypothetical protein PHAVU_002G072400g [Phaseolus vulgaris] Length = 860 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D +DVMKLLQGL SS PKPRHLAQFQVSFESTV Sbjct: 825 LDDSADVMKLLQGLGGSSKPKPRHLAQFQVSFESTV 860 >XP_003519705.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] XP_014620140.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine max] KHN00343.1 Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Glycine soja] KRH69529.1 hypothetical protein GLYMA_02G033500 [Glycine max] KRH69530.1 hypothetical protein GLYMA_02G033500 [Glycine max] Length = 860 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+DP+DV+KLLQGL SS PK RHLAQFQVSFESTV Sbjct: 825 LDDPADVLKLLQGLGASSKPKSRHLAQFQVSFESTV 860 >KHN24134.1 Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Glycine soja] Length = 861 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D SDV+KLLQGLA SSNPKPRHLA QVSFESTV Sbjct: 826 LDDASDVVKLLQGLAASSNPKPRHLAHSQVSFESTV 861 >XP_003552011.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Glycine max] XP_006602379.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 [Glycine max] KRG99311.1 hypothetical protein GLYMA_18G136200 [Glycine max] KRG99312.1 hypothetical protein GLYMA_18G136200 [Glycine max] Length = 861 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D SDV+KLLQGLA SSNPKPRHLA QVSFESTV Sbjct: 826 LDDASDVVKLLQGLAASSNPKPRHLAHSQVSFESTV 861 >ACJ83824.1 unknown, partial [Medicago truncatula] Length = 35 Score = 55.1 bits (131), Expect = 7e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 423 DPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 D +DV+KLL GL TS+N KP+HLAQFQVSFESTV Sbjct: 1 DTTDVVKLLDGLDTSTNQKPKHLAQFQVSFESTV 34 >XP_016202489.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] XP_016202490.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis ipaensis] Length = 860 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D +DV+KLLQGL +SSNPKPRHL FQVSFESTV Sbjct: 825 LDDSADVIKLLQGLGSSSNPKPRHLPHFQVSFESTV 860 >XP_015965010.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] XP_015965011.1 PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 [Arachis duranensis] Length = 860 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 429 LNDPSDVMKLLQGLATSSNPKPRHLAQFQVSFESTV 322 L+D +DV+KLLQGL +SSNPKPRHL FQVSFESTV Sbjct: 825 LDDSADVIKLLQGLGSSSNPKPRHLPHFQVSFESTV 860