BLASTX nr result
ID: Glycyrrhiza31_contig00016468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016468 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_029879328.1 MULTISPECIES: regulation of enolase 1 [Bradyrhizo... 65 3e-10 WP_063193910.1 regulation of enolase 1 [Bradyrhizobium sp. AT1] ... 64 7e-10 WP_026232925.1 regulation of enolase 1 [Bradyrhizobium sp. WSM4349] 63 1e-09 WP_027524957.1 regulation of enolase 1 [Bradyrhizobium sp. Ec3.3] 63 1e-09 WP_057028877.1 regulation of enolase 1 [Bradyrhizobium yuanminge... 62 2e-09 WP_036034340.1 regulation of enolase 1 [Bradyrhizobium yuanminge... 62 2e-09 WP_036022394.1 regulation of enolase 1 [Bradyrhizobium yuanminge... 62 2e-09 WP_036001240.1 regulation of enolase 1 [Bradyrhizobium yuanminge... 62 2e-09 WP_027567781.1 regulation of enolase 1 [Bradyrhizobium sp. URHA0... 62 2e-09 KRQ14597.1 regulation of enolase 1 [Bradyrhizobium manausense] 62 3e-09 EAU67639.1 putative secreted protein [Stigmatella aurantiaca DW4... 62 4e-09 WP_075637391.1 regulation of enolase 1 [Rhizobium sp. MH17] OLP5... 62 4e-09 WP_063958229.1 regulation of enolase 1 [Bradyrhizobium manausense] 62 5e-09 AMA57641.1 regulation of enolase 1 [Bradyrhizobium sp. CCGE-LA001] 61 5e-09 WP_013374410.1 regulation of enolase 1 [Stigmatella aurantiaca] ... 62 6e-09 WP_051256809.1 regulation of enolase 1 [Cystobacter fuscus] 61 7e-09 WP_063921104.1 regulation of enolase 1 [Bradyrhizobium sp. CCGE-... 61 7e-09 SFN74929.1 hypothetical protein SAMN05216330_101448 [Bradyrhizob... 61 8e-09 WP_056478258.1 regulation of enolase 1 [Sphingomonas sp. Leaf38]... 61 8e-09 WP_071903340.1 regulation of enolase 1 [Cystobacter ferrugineus]... 61 8e-09 >WP_029879328.1 MULTISPECIES: regulation of enolase 1 [Bradyrhizobium] KIU43174.1 regulation of enolase 1 [Bradyrhizobium elkanii] OCX30000.1 regulation of enolase 1 [Bradyrhizobium sp. UASWS1016] Length = 197 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FSAF LTPPLGKDLHDL+ Sbjct: 166 PMACTPERAGLEVSFSAFQLTPPLGKDLHDLT 197 >WP_063193910.1 regulation of enolase 1 [Bradyrhizobium sp. AT1] KYG18856.1 regulation of enolase 1 [Bradyrhizobium sp. AT1] Length = 194 Score = 63.5 bits (153), Expect = 7e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGL+V FSAF LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLDVVFSAFHLTPPLGKDLHDLS 194 >WP_026232925.1 regulation of enolase 1 [Bradyrhizobium sp. WSM4349] Length = 194 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FS F LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLEVVFSTFRLTPPLGKDLHDLS 194 >WP_027524957.1 regulation of enolase 1 [Bradyrhizobium sp. Ec3.3] Length = 197 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FS F LTPPLGKDLHDL+ Sbjct: 166 PMACTPERAGLEVAFSTFQLTPPLGKDLHDLT 197 >WP_057028877.1 regulation of enolase 1 [Bradyrhizobium yuanmingense] KRP92100.1 regulation of enolase 1 [Bradyrhizobium yuanmingense] Length = 194 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FS F LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLEVVFSNFRLTPPLGKDLHDLS 194 >WP_036034340.1 regulation of enolase 1 [Bradyrhizobium yuanmingense] Length = 194 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FS F LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLEVVFSNFRLTPPLGKDLHDLS 194 >WP_036022394.1 regulation of enolase 1 [Bradyrhizobium yuanmingense] SCB29217.1 hypothetical protein GA0061099_1004284 [Bradyrhizobium yuanmingense] Length = 194 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FS F LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLEVVFSNFRLTPPLGKDLHDLS 194 >WP_036001240.1 regulation of enolase 1 [Bradyrhizobium yuanmingense] Length = 194 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FS F LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLEVVFSNFRLTPPLGKDLHDLS 194 >WP_027567781.1 regulation of enolase 1 [Bradyrhizobium sp. URHA0013] Length = 194 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEV FSAF L PPLGKDLHDLS Sbjct: 163 PMACTPERAGLEVVFSAFRLRPPLGKDLHDLS 194 >KRQ14597.1 regulation of enolase 1 [Bradyrhizobium manausense] Length = 197 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPER GL VRFS FSL PPLGKDLHDLS Sbjct: 166 PMACTPEREGLRVRFSGFSLKPPLGKDLHDLS 197 >EAU67639.1 putative secreted protein [Stigmatella aurantiaca DW4/3-1] Length = 190 Score = 61.6 bits (148), Expect = 4e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PM+CTPERAGL VRFS F LTPPLGKDLHDL+ Sbjct: 159 PMSCTPERAGLSVRFSEFRLTPPLGKDLHDLT 190 >WP_075637391.1 regulation of enolase 1 [Rhizobium sp. MH17] OLP52569.1 regulation of enolase 1 [Rhizobium sp. MH17] Length = 191 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PM CTPERAGL VRFS F+LTPPLGKDLHDLS Sbjct: 160 PMCCTPERAGLIVRFSDFTLTPPLGKDLHDLS 191 >WP_063958229.1 regulation of enolase 1 [Bradyrhizobium manausense] Length = 237 Score = 62.0 bits (149), Expect = 5e-09 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPER GL VRFS FSL PPLGKDLHDLS Sbjct: 206 PMACTPEREGLRVRFSGFSLKPPLGKDLHDLS 237 >AMA57641.1 regulation of enolase 1 [Bradyrhizobium sp. CCGE-LA001] Length = 194 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGL+V FS F LTPPLGKDLHDLS Sbjct: 163 PMACTPERAGLDVVFSNFRLTPPLGKDLHDLS 194 >WP_013374410.1 regulation of enolase 1 [Stigmatella aurantiaca] ADO68731.1 conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1] Length = 231 Score = 61.6 bits (148), Expect = 6e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PM+CTPERAGL VRFS F LTPPLGKDLHDL+ Sbjct: 200 PMSCTPERAGLSVRFSEFRLTPPLGKDLHDLT 231 >WP_051256809.1 regulation of enolase 1 [Cystobacter fuscus] Length = 212 Score = 61.2 bits (147), Expect = 7e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PM CTPERAGL VRFS F LTPPLGKDLHDL+ Sbjct: 181 PMCCTPERAGLSVRFSEFRLTPPLGKDLHDLT 212 >WP_063921104.1 regulation of enolase 1 [Bradyrhizobium sp. CCGE-LA001] Length = 219 Score = 61.2 bits (147), Expect = 7e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGL+V FS F LTPPLGKDLHDLS Sbjct: 188 PMACTPERAGLDVVFSNFRLTPPLGKDLHDLS 219 >SFN74929.1 hypothetical protein SAMN05216330_101448 [Bradyrhizobium sp. Ghvi] Length = 197 Score = 60.8 bits (146), Expect = 8e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGL V+F+ FSL PPLGKDLHDLS Sbjct: 166 PMACTPERAGLPVKFTEFSLKPPLGKDLHDLS 197 >WP_056478258.1 regulation of enolase 1 [Sphingomonas sp. Leaf38] KQN29406.1 regulation of enolase 1 [Sphingomonas sp. Leaf38] Length = 229 Score = 61.2 bits (147), Expect = 8e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PMACTPERAGLEVRFS S+T PLGKDLHDLS Sbjct: 198 PMACTPERAGLEVRFSDLSITAPLGKDLHDLS 229 >WP_071903340.1 regulation of enolase 1 [Cystobacter ferrugineus] OJH35764.1 regulation of enolase 1 [Cystobacter ferrugineus] Length = 231 Score = 61.2 bits (147), Expect = 8e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 PMACTPERAGLEVRFSAFSLTPPLGKDLHDLS 98 PM CTPERAGL VRFS F LTPPLGKDLHDL+ Sbjct: 200 PMCCTPERAGLSVRFSEFRLTPPLGKDLHDLT 231