BLASTX nr result
ID: Glycyrrhiza31_contig00016441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016441 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003619779.1 hypothetical protein MTR_6g068890 [Medicago trunc... 50 7e-06 >XP_003619779.1 hypothetical protein MTR_6g068890 [Medicago truncatula] AES75997.1 hypothetical protein MTR_6g068890 [Medicago truncatula] Length = 91 Score = 50.4 bits (119), Expect = 7e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +3 Query: 198 VWQN*WCLLQGLNPGAQHMNNLLSLEGIEVMD 293 VW+ WCLLQG NP A+ MNNLLS +G+E +D Sbjct: 60 VWRKQWCLLQGFNPAAEGMNNLLSFKGLEALD 91