BLASTX nr result
ID: Glycyrrhiza31_contig00016415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016415 (348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY26445.1 hypothetical protein MANES_16G048000 [Manihot esculenta] 52 1e-05 >OAY26445.1 hypothetical protein MANES_16G048000 [Manihot esculenta] Length = 186 Score = 52.0 bits (123), Expect = 1e-05 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +2 Query: 122 GRKVEDPELLKLIHLTILNNTIDYHPVQKFLLVLI 226 GRKVEDPELL+ I LTI+NN + YHPV F+L+ I Sbjct: 139 GRKVEDPELLEAIRLTIINNLLQYHPVMLFVLLFI 173