BLASTX nr result
ID: Glycyrrhiza31_contig00016217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016217 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT90544.1 hypothetical protein VIGAN_06180500 [Vigna angularis ... 50 7e-06 XP_007132285.1 hypothetical protein PHAVU_011G082100g [Phaseolus... 50 9e-06 >BAT90544.1 hypothetical protein VIGAN_06180500 [Vigna angularis var. angularis] Length = 84 Score = 50.1 bits (118), Expect = 7e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 263 HHKIPPKDYDKPGSGQRITTANEGNHRYIPRPEY 162 HH+IP K+Y KPGSGQR T + E NH YIPR +Y Sbjct: 44 HHQIPRKEYGKPGSGQR-TVSEEFNHHYIPRKDY 76 >XP_007132285.1 hypothetical protein PHAVU_011G082100g [Phaseolus vulgaris] ESW04279.1 hypothetical protein PHAVU_011G082100g [Phaseolus vulgaris] Length = 84 Score = 49.7 bits (117), Expect = 9e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 263 HHKIPPKDYDKPGSGQRITTANEGNHRYIPRPEY 162 HH+IP K+Y KPGSGQR T + E NH YIPR +Y Sbjct: 44 HHQIPRKEYGKPGSGQR-TISEEFNHHYIPRKDY 76