BLASTX nr result
ID: Glycyrrhiza31_contig00016202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016202 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013447859.1 hypothetical protein MTR_7g023270 [Medicago trunc... 42 1e-07 >XP_013447859.1 hypothetical protein MTR_7g023270 [Medicago truncatula] KEH21886.1 hypothetical protein MTR_7g023270 [Medicago truncatula] Length = 78 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -3 Query: 224 KRTCDVESRCSSNNNKEYYRGNDGHLFKRCFRQ 126 KR CDVESRCSSNNN+ YYR + RQ Sbjct: 27 KRICDVESRCSSNNNEVYYRATMNTFSREVVRQ 59 Score = 40.8 bits (94), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -2 Query: 144 QEMFQTTWEAHIHQTPSLEYFVPDM 70 +E+ + TWE HIH+TPS +Y+VPDM Sbjct: 54 REVVRQTWETHIHKTPSPKYYVPDM 78