BLASTX nr result
ID: Glycyrrhiza31_contig00016144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00016144 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42084.1 hypothetical protein CISIN_1g034429mg [Citrus sinensis] 97 6e-24 XP_015868935.1 PREDICTED: serine hydroxymethyltransferase 4-like... 100 1e-23 KYP54869.1 Heat stress transcription factor A-5 [Cajanus cajan] 103 1e-23 XP_006421026.1 hypothetical protein CICLE_v10006893mg, partial [... 96 2e-23 XP_007146362.1 hypothetical protein PHAVU_006G034200g [Phaseolus... 103 2e-23 XP_007224622.1 hypothetical protein PRUPE_ppa026865mg [Prunus pe... 97 3e-23 XP_012486952.1 PREDICTED: heat stress transcription factor A-5-l... 102 6e-23 XP_003524927.1 PREDICTED: heat stress transcription factor A-5-l... 102 6e-23 GAV58976.1 HSF_DNA-bind domain-containing protein [Cephalotus fo... 102 9e-23 XP_017608522.1 PREDICTED: heat stress transcription factor A-5-l... 101 2e-22 XP_016733523.1 PREDICTED: heat stress transcription factor A-5-l... 101 2e-22 KHG10899.1 Heat stress transcription factor A-5 -like protein [G... 101 2e-22 NP_001313701.1 heat stress transcription factor A-5-like [Gossyp... 101 2e-22 XP_017434134.1 PREDICTED: heat stress transcription factor A-5-l... 101 2e-22 XP_003531216.1 PREDICTED: heat stress transcription factor A-5-l... 100 2e-22 XP_017975850.1 PREDICTED: heat stress transcription factor A-5 [... 100 2e-22 EOY05139.1 Winged-helix DNA-binding transcription factor family ... 100 2e-22 XP_015868967.1 PREDICTED: heat stress transcription factor A-5-l... 100 4e-22 KNA06739.1 hypothetical protein SOVF_178240 [Spinacia oleracea] 100 4e-22 XP_016175574.1 PREDICTED: heat stress transcription factor A-5-l... 100 6e-22 >KDO42084.1 hypothetical protein CISIN_1g034429mg [Citrus sinensis] Length = 95 Score = 97.4 bits (241), Expect = 6e-24 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FL+KTYDMVDDSSTD+IVSWS SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 20 FLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTYFKHNNF 68 >XP_015868935.1 PREDICTED: serine hydroxymethyltransferase 4-like [Ziziphus jujuba] Length = 217 Score = 100 bits (248), Expect = 1e-23 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSSTD+IVSWSS TSFVVWNPPEFARLLLPT+FKHNNF Sbjct: 18 FLLKTYDMVDDSSTDEIVSWSSVKTSFVVWNPPEFARLLLPTFFKHNNF 66 >KYP54869.1 Heat stress transcription factor A-5 [Cajanus cajan] Length = 404 Score = 103 bits (257), Expect = 1e-23 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSST+DIVSWSSTN SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 16 FLLKTYDMVDDSSTNDIVSWSSTNNSFVVWNPPEFARLLLPTYFKHNNF 64 >XP_006421026.1 hypothetical protein CICLE_v10006893mg, partial [Citrus clementina] ESR34266.1 hypothetical protein CICLE_v10006893mg, partial [Citrus clementina] Length = 78 Score = 95.9 bits (237), Expect = 2e-23 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FL+KTYDMVDDSSTD+IVSWS SFVVWNPPEFARLLLPT+FKHNNF Sbjct: 20 FLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTFFKHNNF 68 >XP_007146362.1 hypothetical protein PHAVU_006G034200g [Phaseolus vulgaris] ESW18356.1 hypothetical protein PHAVU_006G034200g [Phaseolus vulgaris] Length = 487 Score = 103 bits (257), Expect = 2e-23 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSST DIVSWSS+NTSFVVWNPPEFARLLLPTYFKHNNF Sbjct: 21 FLLKTYDMVDDSSTSDIVSWSSSNTSFVVWNPPEFARLLLPTYFKHNNF 69 >XP_007224622.1 hypothetical protein PRUPE_ppa026865mg [Prunus persica] Length = 135 Score = 97.1 bits (240), Expect = 3e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TD+IVSWS+ SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 16 FLLKTYDMVDDSATDEIVSWSTNKKSFVVWNPPEFARLLLPTYFKHNNF 64 >XP_012486952.1 PREDICTED: heat stress transcription factor A-5-like [Gossypium raimondii] KJB37851.1 hypothetical protein B456_006G224000 [Gossypium raimondii] Length = 475 Score = 102 bits (254), Expect = 6e-23 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TDDIVSWSS N SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 24 FLLKTYDMVDDSATDDIVSWSSNNNSFVVWNPPEFARLLLPTYFKHNNF 72 >XP_003524927.1 PREDICTED: heat stress transcription factor A-5-like [Glycine max] KRH58845.1 hypothetical protein GLYMA_05G151800 [Glycine max] Length = 479 Score = 102 bits (254), Expect = 6e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDD+ST+DIVSWSSTN SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 16 FLLKTYDMVDDASTNDIVSWSSTNNSFVVWNPPEFARLLLPTYFKHNNF 64 >GAV58976.1 HSF_DNA-bind domain-containing protein [Cephalotus follicularis] Length = 485 Score = 102 bits (253), Expect = 9e-23 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSSTD+IVSWSS N SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 17 FLLKTYDMVDDSSTDEIVSWSSNNNSFVVWNPPEFARLLLPTYFKHNNF 65 >XP_017608522.1 PREDICTED: heat stress transcription factor A-5-like [Gossypium arboreum] Length = 477 Score = 101 bits (251), Expect = 2e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TDDIVSWSS N SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 24 FLLKTYDMVDDSATDDIVSWSSHNKSFVVWNPPEFARLLLPTYFKHNNF 72 >XP_016733523.1 PREDICTED: heat stress transcription factor A-5-like [Gossypium hirsutum] Length = 477 Score = 101 bits (251), Expect = 2e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TDDIVSWSS N SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 24 FLLKTYDMVDDSATDDIVSWSSHNKSFVVWNPPEFARLLLPTYFKHNNF 72 >KHG10899.1 Heat stress transcription factor A-5 -like protein [Gossypium arboreum] Length = 477 Score = 101 bits (251), Expect = 2e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TDDIVSWSS N SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 24 FLLKTYDMVDDSATDDIVSWSSYNKSFVVWNPPEFARLLLPTYFKHNNF 72 >NP_001313701.1 heat stress transcription factor A-5-like [Gossypium hirsutum] AIG20085.1 HSF18 [Gossypium hirsutum] Length = 477 Score = 101 bits (251), Expect = 2e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TDDIVSWSS N SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 24 FLLKTYDMVDDSATDDIVSWSSHNKSFVVWNPPEFARLLLPTYFKHNNF 72 >XP_017434134.1 PREDICTED: heat stress transcription factor A-5-like [Vigna angularis] KOM52228.1 hypothetical protein LR48_Vigan09g088700 [Vigna angularis] BAT88968.1 hypothetical protein VIGAN_05262000 [Vigna angularis var. angularis] Length = 484 Score = 101 bits (251), Expect = 2e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDD ST+DIVSWSS NTSFVVWNPPEFARLLLPTYFKHNNF Sbjct: 22 FLLKTYDMVDDPSTNDIVSWSSCNTSFVVWNPPEFARLLLPTYFKHNNF 70 >XP_003531216.1 PREDICTED: heat stress transcription factor A-5-like isoform X1 [Glycine max] KHN12346.1 Heat stress transcription factor A-5 [Glycine soja] KRH42748.1 hypothetical protein GLYMA_08G108600 [Glycine max] Length = 477 Score = 100 bits (250), Expect = 2e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTY+MVDD+ST+DIVSWSSTN SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 14 FLLKTYEMVDDASTNDIVSWSSTNNSFVVWNPPEFARLLLPTYFKHNNF 62 >XP_017975850.1 PREDICTED: heat stress transcription factor A-5 [Theobroma cacao] Length = 490 Score = 100 bits (250), Expect = 2e-22 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSSTDDIVSWSS SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 21 FLLKTYDMVDDSSTDDIVSWSSNKKSFVVWNPPEFARLLLPTYFKHNNF 69 >EOY05139.1 Winged-helix DNA-binding transcription factor family protein [Theobroma cacao] Length = 490 Score = 100 bits (250), Expect = 2e-22 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSSTDDIVSWSS SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 21 FLLKTYDMVDDSSTDDIVSWSSNKKSFVVWNPPEFARLLLPTYFKHNNF 69 >XP_015868967.1 PREDICTED: heat stress transcription factor A-5-like [Ziziphus jujuba] XP_015870139.1 PREDICTED: heat stress transcription factor A-5-like [Ziziphus jujuba] Length = 470 Score = 100 bits (248), Expect = 4e-22 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSSTD+IVSWSS TSFVVWNPPEFARLLLPT+FKHNNF Sbjct: 18 FLLKTYDMVDDSSTDEIVSWSSVKTSFVVWNPPEFARLLLPTFFKHNNF 66 >KNA06739.1 hypothetical protein SOVF_178240 [Spinacia oleracea] Length = 487 Score = 100 bits (248), Expect = 4e-22 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSWSSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDSSTD+IVSWSS+N SF+VWNPPEFARLLLPT+FKHNNF Sbjct: 16 FLLKTYDMVDDSSTDNIVSWSSSNASFIVWNPPEFARLLLPTFFKHNNF 64 >XP_016175574.1 PREDICTED: heat stress transcription factor A-5-like [Arachis ipaensis] Length = 479 Score = 99.8 bits (247), Expect = 6e-22 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 1/50 (2%) Frame = +3 Query: 255 FLLKTYDMVDDSSTDDIVSW-SSTNTSFVVWNPPEFARLLLPTYFKHNNF 401 FLLKTYDMVDDS+TDDIVSW SSTN SFVVWNPPEFARLLLPTYFKHNNF Sbjct: 20 FLLKTYDMVDDSATDDIVSWNSSTNNSFVVWNPPEFARLLLPTYFKHNNF 69