BLASTX nr result
ID: Glycyrrhiza31_contig00015971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00015971 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015949824.1 PREDICTED: OTU domain-containing protein At3g5781... 69 5e-11 XP_016183618.1 PREDICTED: OTU domain-containing protein At3g5781... 69 7e-11 XP_015949825.1 PREDICTED: OTU domain-containing protein At3g5781... 69 7e-11 XP_006588483.1 PREDICTED: uncharacterized protein LOC100810338 i... 69 7e-11 NP_001242273.1 uncharacterized protein LOC100810338 [Glycine max... 69 7e-11 XP_013467527.1 OTU-like cysteine protease [Medicago truncatula] ... 67 1e-10 KYP73949.1 hypothetical protein KK1_006610 [Cajanus cajan] 68 2e-10 OIW20669.1 hypothetical protein TanjilG_19734 [Lupinus angustifo... 67 3e-10 XP_019431502.1 PREDICTED: OTU domain-containing protein At3g5781... 67 4e-10 XP_007145652.1 hypothetical protein PHAVU_007G257000g [Phaseolus... 66 9e-10 XP_017413417.1 PREDICTED: OTU domain-containing protein At3g5781... 65 1e-09 XP_014511172.1 PREDICTED: OTU domain-containing protein At3g5781... 65 1e-09 BAT96416.1 hypothetical protein VIGAN_08335400 [Vigna angularis ... 65 1e-09 XP_004497941.1 PREDICTED: OTU domain-containing protein At3g5781... 64 6e-09 XP_013467530.1 OTU-like cysteine protease [Medicago truncatula] ... 63 8e-09 GAU33385.1 hypothetical protein TSUD_20780 [Trifolium subterraneum] 62 2e-08 XP_002534273.1 PREDICTED: OTU domain-containing protein At3g5781... 59 2e-07 XP_010913126.1 PREDICTED: OTU domain-containing protein At3g5781... 59 2e-07 XP_010913129.2 PREDICTED: OTU domain-containing protein At3g5781... 59 2e-07 XP_011467991.1 PREDICTED: LOW QUALITY PROTEIN: OTU domain-contai... 57 5e-07 >XP_015949824.1 PREDICTED: OTU domain-containing protein At3g57810-like isoform X1 [Arachis duranensis] Length = 288 Score = 68.9 bits (167), Expect = 5e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRRKGPKPRL Sbjct: 259 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 288 >XP_016183618.1 PREDICTED: OTU domain-containing protein At3g57810-like [Arachis ipaensis] Length = 333 Score = 68.9 bits (167), Expect = 7e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRRKGPKPRL Sbjct: 304 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 333 >XP_015949825.1 PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Arachis duranensis] Length = 333 Score = 68.9 bits (167), Expect = 7e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRRKGPKPRL Sbjct: 304 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 333 >XP_006588483.1 PREDICTED: uncharacterized protein LOC100810338 isoform X1 [Glycine max] XP_014618057.1 PREDICTED: uncharacterized protein LOC100810338 isoform X1 [Glycine max] KHN46336.1 OTU domain-containing protein [Glycine soja] KRH33009.1 hypothetical protein GLYMA_10G093300 [Glycine max] KRH33010.1 hypothetical protein GLYMA_10G093300 [Glycine max] KRH33011.1 hypothetical protein GLYMA_10G093300 [Glycine max] KRH33012.1 hypothetical protein GLYMA_10G093300 [Glycine max] Length = 339 Score = 68.9 bits (167), Expect = 7e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRRKGPKPRL Sbjct: 310 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 339 >NP_001242273.1 uncharacterized protein LOC100810338 [Glycine max] ACU23423.1 unknown [Glycine max] Length = 339 Score = 68.9 bits (167), Expect = 7e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRRKGPKPRL Sbjct: 310 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 339 >XP_013467527.1 OTU-like cysteine protease [Medicago truncatula] KEH41564.1 OTU-like cysteine protease [Medicago truncatula] Length = 221 Score = 67.0 bits (162), Expect = 1e-10 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIP--RRKGPKPRL*HFTFQMWKRL 125 KENPIRVLY+GF HYDALE P RRKG K RL HFTFQM KRL Sbjct: 175 KENPIRVLYNGFTHYDALEFPISRRKGSKSRLWHFTFQMLKRL 217 >KYP73949.1 hypothetical protein KK1_006610 [Cajanus cajan] Length = 339 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIP+RKGPKPRL Sbjct: 310 KENPIRVLYHGFGHYDALEIPKRKGPKPRL 339 >OIW20669.1 hypothetical protein TanjilG_19734 [Lupinus angustifolius] Length = 313 Score = 67.0 bits (162), Expect = 3e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRR GPKPRL Sbjct: 284 KENPIRVLYHGFGHYDALEIPRRNGPKPRL 313 >XP_019431502.1 PREDICTED: OTU domain-containing protein At3g57810 [Lupinus angustifolius] XP_019431503.1 PREDICTED: OTU domain-containing protein At3g57810 [Lupinus angustifolius] Length = 338 Score = 67.0 bits (162), Expect = 4e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIPRR GPKPRL Sbjct: 309 KENPIRVLYHGFGHYDALEIPRRNGPKPRL 338 >XP_007145652.1 hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] ESW17646.1 hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] Length = 339 Score = 65.9 bits (159), Expect = 9e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIP RKGPKPRL Sbjct: 310 KENPIRVLYHGFGHYDALEIPIRKGPKPRL 339 >XP_017413417.1 PREDICTED: OTU domain-containing protein At3g57810-like [Vigna angularis] KOM34133.1 hypothetical protein LR48_Vigan02g028300 [Vigna angularis] Length = 338 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDAL+IP RKGPKPRL Sbjct: 309 KENPIRVLYHGFGHYDALDIPTRKGPKPRL 338 >XP_014511172.1 PREDICTED: OTU domain-containing protein At3g57810-like [Vigna radiata var. radiata] Length = 339 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDAL+IP RKGPKPRL Sbjct: 310 KENPIRVLYHGFGHYDALDIPTRKGPKPRL 339 >BAT96416.1 hypothetical protein VIGAN_08335400 [Vigna angularis var. angularis] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDAL+IP RKGPKPRL Sbjct: 321 KENPIRVLYHGFGHYDALDIPTRKGPKPRL 350 >XP_004497941.1 PREDICTED: OTU domain-containing protein At3g57810-like [Cicer arietinum] Length = 337 Score = 63.5 bits (153), Expect = 6e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDAL+IP+RKGPK RL Sbjct: 308 KENPIRVLYHGFGHYDALDIPKRKGPKSRL 337 >XP_013467530.1 OTU-like cysteine protease [Medicago truncatula] KEH41567.1 OTU-like cysteine protease [Medicago truncatula] Length = 337 Score = 63.2 bits (152), Expect = 8e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALE+P++KGPK RL Sbjct: 308 KENPIRVLYHGFGHYDALEVPKKKGPKSRL 337 >GAU33385.1 hypothetical protein TSUD_20780 [Trifolium subterraneum] Length = 337 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDALEIP +KGPK RL Sbjct: 308 KENPIRVLYHGFGHYDALEIPTKKGPKSRL 337 >XP_002534273.1 PREDICTED: OTU domain-containing protein At3g57810 [Ricinus communis] XP_015583893.1 PREDICTED: OTU domain-containing protein At3g57810 [Ricinus communis] EEF28110.1 cysteine-type peptidase, putative [Ricinus communis] Length = 343 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 K+NPIRVLYHGFGHYDAL+IP RKG KP+L Sbjct: 314 KDNPIRVLYHGFGHYDALQIPGRKGGKPKL 343 >XP_010913126.1 PREDICTED: OTU domain-containing protein At3g57810 isoform X2 [Elaeis guineensis] XP_010913127.1 PREDICTED: OTU domain-containing protein At3g57810 isoform X2 [Elaeis guineensis] XP_010913128.1 PREDICTED: OTU domain-containing protein At3g57810 isoform X2 [Elaeis guineensis] Length = 310 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KE+PIRVLYHGFGHYDAL+IP +KGPK RL Sbjct: 281 KEDPIRVLYHGFGHYDALQIPGKKGPKSRL 310 >XP_010913129.2 PREDICTED: OTU domain-containing protein At3g57810 isoform X1 [Elaeis guineensis] Length = 314 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KE+PIRVLYHGFGHYDAL+IP +KGPK RL Sbjct: 285 KEDPIRVLYHGFGHYDALQIPGKKGPKSRL 314 >XP_011467991.1 PREDICTED: LOW QUALITY PROTEIN: OTU domain-containing protein At3g57810 [Fragaria vesca subsp. vesca] Length = 176 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KENPIRVLYHGFGHYDALEIPRRKGPKPRL 92 KENPIRVLYHGFGHYDAL IP +G KPRL Sbjct: 147 KENPIRVLYHGFGHYDALHIPGVRGGKPRL 176