BLASTX nr result
ID: Glycyrrhiza31_contig00015940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00015940 (396 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH63527.1 hypothetical protein GLYMA_04G182800 [Glycine max] 43 5e-06 >KRH63527.1 hypothetical protein GLYMA_04G182800 [Glycine max] Length = 65 Score = 42.7 bits (99), Expect(2) = 5e-06 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -2 Query: 281 KQDLDAKDERNIH*RGYRKE-MVTCHFLCKSLPLYFLLFLV 162 KQD AK R I+ RGYRKE +V C FLCKS+ YFLLFL+ Sbjct: 4 KQDWKAK-MRGIYNRGYRKEKLVMCQFLCKSI-TYFLLFLL 42 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -3 Query: 139 LGFVGMNMNTTLSSVWQCRWTGLVTL 62 LGF+GMN + WQC WTGLVTL Sbjct: 46 LGFLGMN------TTWQCCWTGLVTL 65