BLASTX nr result
ID: Glycyrrhiza31_contig00015551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00015551 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003519413.1 PREDICTED: uncharacterized protein LOC100795088 [... 54 5e-06 >XP_003519413.1 PREDICTED: uncharacterized protein LOC100795088 [Glycine max] XP_006575549.1 PREDICTED: uncharacterized protein LOC100795088 [Glycine max] KHN38558.1 hypothetical protein glysoja_004223 [Glycine soja] KRH73231.1 hypothetical protein GLYMA_02G260500 [Glycine max] Length = 558 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 278 MVSVEDGKDEIQESNGSKAKEFASIDISTSR 370 MVSV++GKDEI+ESNGSK EFASIDISTSR Sbjct: 1 MVSVDNGKDEIEESNGSKVNEFASIDISTSR 31