BLASTX nr result
ID: Glycyrrhiza31_contig00014953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014953 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019433737.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 XP_013463553.1 PPR containing plant-like protein [Medicago trunc... 67 2e-10 GAU37235.1 hypothetical protein TSUD_375370 [Trifolium subterran... 65 7e-10 XP_006577946.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 XP_014499654.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 XP_017434492.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-07 >XP_019433737.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Lupinus angustifolius] Length = 581 Score = 72.0 bits (175), Expect = 2e-12 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 15/93 (16%) Frame = -3 Query: 235 ENRNSET-----ARDQRFPRTGFIC--DESTTYGVPKHVTFTTLSDA--------AGPED 101 +N+N E+ AR R RTG IC ++ T GV K + + L+ A E+ Sbjct: 14 KNKNRESHPPKHARGVRKIRTGCICGHEDDTIDGVTKQMALSILNPISSNIDVYRASSEE 73 Query: 100 MGSIRRAEAWFIKIACTVFVRSNSLDRFFNYFS 2 +G IRRAE WF+K+ CTVFVR+NSLDRF +YFS Sbjct: 74 IGPIRRAETWFVKLICTVFVRNNSLDRFISYFS 106 >XP_013463553.1 PPR containing plant-like protein [Medicago truncatula] KEH37588.1 PPR containing plant-like protein [Medicago truncatula] Length = 548 Score = 66.6 bits (161), Expect = 2e-10 Identities = 37/56 (66%), Positives = 41/56 (73%) Frame = -3 Query: 169 STTYGVPKHVTFTTLSDAAGPEDMGSIRRAEAWFIKIACTVFVRSNSLDRFFNYFS 2 STT VP+HVT LSDAA P MG IRRA+AWF+K+A TVFVR S DRF YFS Sbjct: 17 STTNAVPRHVT---LSDAALPT-MGPIRRADAWFVKLASTVFVRYTSFDRFIFYFS 68 >GAU37235.1 hypothetical protein TSUD_375370 [Trifolium subterraneum] Length = 554 Score = 64.7 bits (156), Expect = 7e-10 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -3 Query: 151 PKHVTFTTLSDAAGPEDMGSIRRAEAWFIKIACTVFVRSNSLDRFFNYFS 2 P+HVT LSD A MGSI++AEAWF+KIACTVFVR NS DRF YFS Sbjct: 31 PRHVT---LSDVAS---MGSIKKAEAWFVKIACTVFVRYNSFDRFVFYFS 74 >XP_006577946.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] XP_006577947.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] XP_014629899.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] XP_014629900.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] KRH60959.1 hypothetical protein GLYMA_04G019000 [Glycine max] Length = 510 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 100 MGSIRRAEAWFIKIACTVFVRSNSLDRFFNYFS 2 MGSIRRAEAWF+KIACTVFVRSNSLD F YFS Sbjct: 1 MGSIRRAEAWFVKIACTVFVRSNSLDPFVGYFS 33 >XP_014499654.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna radiata var. radiata] XP_014499655.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna radiata var. radiata] XP_014499656.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna radiata var. radiata] XP_014499657.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna radiata var. radiata] Length = 520 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 100 MGSIRRAEAWFIKIACTVFVRSNSLDRFFNYFS 2 MGSIR AEAWF+KIACT+FVRS+S+D F YFS Sbjct: 1 MGSIRMAEAWFVKIACTIFVRSSSVDPFLGYFS 33 >XP_017434492.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] XP_017434493.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] XP_017434494.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] XP_017434495.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] XP_017434496.1 PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] KOM51708.1 hypothetical protein LR48_Vigan09g036700 [Vigna angularis] BAT77635.1 hypothetical protein VIGAN_02022400 [Vigna angularis var. angularis] Length = 520 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 100 MGSIRRAEAWFIKIACTVFVRSNSLDRFFNYFS 2 MGSIR AEAWF+KIACT+FVRS+S+D F YFS Sbjct: 1 MGSIRMAEAWFVKIACTIFVRSSSVDPFLGYFS 33