BLASTX nr result
ID: Glycyrrhiza31_contig00014920
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014920 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014520804.1 PREDICTED: mechanosensitive ion channel protein 2... 59 1e-07 XP_017406628.1 PREDICTED: mechanosensitive ion channel protein 2... 59 1e-07 GAU23329.1 hypothetical protein TSUD_237830 [Trifolium subterran... 58 3e-07 KHN14509.1 Mechanosensitive ion channel protein 2, chloroplastic... 57 5e-07 XP_003613048.2 mechanosensitive ion channel-like protein [Medica... 57 9e-07 XP_006573000.1 PREDICTED: mechanosensitive ion channel protein 2... 57 9e-07 KYP66340.1 MscS family inner membrane protein ynaI [Cajanus cajan] 55 3e-06 XP_003533418.1 PREDICTED: mechanosensitive ion channel protein 2... 55 3e-06 XP_019421403.1 PREDICTED: mechanosensitive ion channel protein 2... 55 4e-06 XP_019421402.1 PREDICTED: mechanosensitive ion channel protein 2... 55 4e-06 XP_019421399.1 PREDICTED: mechanosensitive ion channel protein 2... 55 4e-06 >XP_014520804.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic [Vigna radiata var. radiata] XP_014520806.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic [Vigna radiata var. radiata] Length = 701 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTG 7 MALPGSLQLSHGLGLCRNL CNKH R TG Sbjct: 1 MALPGSLQLSHGLGLCRNLGCNKHSRATG 29 >XP_017406628.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Vigna angularis] XP_017406630.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Vigna angularis] BAT99456.1 hypothetical protein VIGAN_10090000 [Vigna angularis var. angularis] Length = 705 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTG 7 MALPGSLQLSHGLGLCRNL CNKH R TG Sbjct: 1 MALPGSLQLSHGLGLCRNLGCNKHSRATG 29 >GAU23329.1 hypothetical protein TSUD_237830 [Trifolium subterraneum] Length = 694 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGRC 1 MALPGSLQLSHGLGLCRNLS NK RV GRC Sbjct: 1 MALPGSLQLSHGLGLCRNLSSNKDMRVKGRC 31 >KHN14509.1 Mechanosensitive ion channel protein 2, chloroplastic [Glycine soja] Length = 719 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGR 4 M LPGSLQLSHGLGLCRNL CNKH R GR Sbjct: 1 MTLPGSLQLSHGLGLCRNLDCNKHSRAMGR 30 >XP_003613048.2 mechanosensitive ion channel-like protein [Medicago truncatula] AES96006.2 mechanosensitive ion channel-like protein [Medicago truncatula] Length = 705 Score = 56.6 bits (135), Expect = 9e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGRC 1 MALPGSLQLSHGLGLCRNL+ NK RV GRC Sbjct: 1 MALPGSLQLSHGLGLCRNLNSNKDRRVKGRC 31 >XP_006573000.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Glycine max] XP_006573001.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Glycine max] XP_006573002.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Glycine max] KRH74488.1 hypothetical protein GLYMA_01G023200 [Glycine max] Length = 719 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGR 4 M LPGSLQLSHGLGLCRNL CNKH R GR Sbjct: 1 MTLPGSLQLSHGLGLCRNLDCNKHLRAMGR 30 >KYP66340.1 MscS family inner membrane protein ynaI [Cajanus cajan] Length = 662 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGR 4 MALPGSLQLSHGL LCRNL CNK+ R TGR Sbjct: 1 MALPGSLQLSHGLVLCRNLGCNKNSRATGR 30 >XP_003533418.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] XP_006587572.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] XP_014617783.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] XP_014617784.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] KRH39450.1 hypothetical protein GLYMA_09G199100 [Glycine max] KRH39451.1 hypothetical protein GLYMA_09G199100 [Glycine max] KRH39452.1 hypothetical protein GLYMA_09G199100 [Glycine max] Length = 719 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPR 16 MALPGSLQLSHGLGLCRNL CNKH R Sbjct: 1 MALPGSLQLSHGLGLCRNLDCNKHSR 26 >XP_019421403.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X3 [Lupinus angustifolius] Length = 543 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGR 4 MALPG++QLSHGLGLC NL CNKHP GR Sbjct: 1 MALPGTMQLSHGLGLCMNLRCNKHPGAIGR 30 >XP_019421402.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 546 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGR 4 MALPG++QLSHGLGLC NL CNKHP GR Sbjct: 1 MALPGTMQLSHGLGLCMNLRCNKHPGAIGR 30 >XP_019421399.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Lupinus angustifolius] XP_019421400.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Lupinus angustifolius] XP_019421401.1 PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Lupinus angustifolius] Length = 671 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 93 MALPGSLQLSHGLGLCRNLSCNKHPRVTGR 4 MALPG++QLSHGLGLC NL CNKHP GR Sbjct: 1 MALPGTMQLSHGLGLCMNLRCNKHPGAIGR 30