BLASTX nr result
ID: Glycyrrhiza31_contig00014909
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014909 (348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014515905.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 71 1e-12 XP_017408868.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 71 1e-12 KYP77145.1 Ubiquinone biosynthesis protein COQ4 isogeny [Cajanus... 70 3e-12 XP_007135123.1 hypothetical protein PHAVU_010G102900g [Phaseolus... 69 5e-12 XP_007144551.1 hypothetical protein PHAVU_007G165400g [Phaseolus... 65 2e-11 GAU23368.1 hypothetical protein TSUD_334150 [Trifolium subterran... 68 2e-11 EEF50733.1 ubiquinone biosynthesis protein, putative [Ricinus co... 67 3e-11 XP_015575515.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 67 4e-11 XP_007144552.1 hypothetical protein PHAVU_007G165400g [Phaseolus... 65 4e-11 XP_015584446.1 PREDICTED: LOW QUALITY PROTEIN: ubiquinone biosyn... 67 6e-11 XP_008360087.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 65 7e-11 XP_019434267.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 66 7e-11 KHN26932.1 Ubiquinone biosynthesis protein COQ4 like, mitochondr... 66 1e-10 XP_006582901.1 PREDICTED: uncharacterized protein LOC100787101 i... 66 1e-10 XP_009356420.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 65 2e-10 XP_008367033.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 65 2e-10 XP_008243830.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 65 2e-10 XP_007227569.1 hypothetical protein PRUPE_ppa010913mg [Prunus pe... 65 2e-10 XP_004489686.1 PREDICTED: ubiquinone biosynthesis protein COQ4 h... 65 3e-10 KJB30479.1 hypothetical protein B456_005G145900 [Gossypium raimo... 64 3e-10 >XP_014515905.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vigna radiata var. radiata] XP_014515906.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vigna radiata var. radiata] XP_014515907.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vigna radiata var. radiata] Length = 224 Score = 70.9 bits (172), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYERHFHEDLEDVRRKLQIVPAP V Sbjct: 192 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPVV 223 >XP_017408868.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vigna angularis] XP_017408869.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vigna angularis] XP_017408871.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vigna angularis] KOM28416.1 hypothetical protein LR48_Vigan543s000400 [Vigna angularis] BAT97988.1 hypothetical protein VIGAN_09158700 [Vigna angularis var. angularis] Length = 224 Score = 70.9 bits (172), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYERHFHEDLEDVRRKLQIVPAP V Sbjct: 192 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPVV 223 >KYP77145.1 Ubiquinone biosynthesis protein COQ4 isogeny [Cajanus cajan] Length = 224 Score = 70.1 bits (170), Expect = 3e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYERHFHEDLEDVRRKLQI+PAP V Sbjct: 192 CTDLMCVYYERHFHEDLEDVRRKLQIIPAPIV 223 >XP_007135123.1 hypothetical protein PHAVU_010G102900g [Phaseolus vulgaris] ESW07117.1 hypothetical protein PHAVU_010G102900g [Phaseolus vulgaris] Length = 224 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYERHFHEDLEDVRRKLQIVP+P V Sbjct: 192 CTDLMCVYYERHFHEDLEDVRRKLQIVPSPIV 223 >XP_007144551.1 hypothetical protein PHAVU_007G165400g [Phaseolus vulgaris] ESW16545.1 hypothetical protein PHAVU_007G165400g [Phaseolus vulgaris] Length = 115 Score = 65.5 bits (158), Expect = 2e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 C DLMCVYYE+HFHEDLEDVRRKLQIVP+P V Sbjct: 83 CIDLMCVYYEQHFHEDLEDVRRKLQIVPSPIV 114 >GAU23368.1 hypothetical protein TSUD_334150 [Trifolium subterraneum] Length = 226 Score = 67.8 bits (164), Expect = 2e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDLEDVRRKL+IVP PAV Sbjct: 194 CTDLMCVYYEQHFHEDLEDVRRKLRIVPVPAV 225 >EEF50733.1 ubiquinone biosynthesis protein, putative [Ricinus communis] Length = 199 Score = 67.0 bits (162), Expect = 3e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDL+DVRRKL I+PAPAV Sbjct: 162 CTDLMCVYYEKHFHEDLDDVRRKLGIIPAPAV 193 >XP_015575515.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Ricinus communis] EEF41933.1 ubiquinone biosynthesis protein, putative [Ricinus communis] Length = 230 Score = 67.0 bits (162), Expect = 4e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDL+DVRRKL I+PAPAV Sbjct: 193 CTDLMCVYYEKHFHEDLDDVRRKLGIIPAPAV 224 >XP_007144552.1 hypothetical protein PHAVU_007G165400g [Phaseolus vulgaris] ESW16546.1 hypothetical protein PHAVU_007G165400g [Phaseolus vulgaris] Length = 150 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 C DLMCVYYE+HFHEDLEDVRRKLQIVP+P V Sbjct: 118 CIDLMCVYYEQHFHEDLEDVRRKLQIVPSPIV 149 >XP_015584446.1 PREDICTED: LOW QUALITY PROTEIN: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Ricinus communis] Length = 268 Score = 67.0 bits (162), Expect = 6e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDL+DVRRKL I+PAPAV Sbjct: 231 CTDLMCVYYEKHFHEDLDDVRRKLGIIPAPAV 262 >XP_008360087.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like [Malus domestica] Length = 173 Score = 65.5 bits (158), Expect = 7e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPA 255 CTDLMCVYYERHFHEDLEDVRRK I+PAPA Sbjct: 138 CTDLMCVYYERHFHEDLEDVRRKWGIIPAPA 168 >XP_019434267.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial isoform X1 [Lupinus angustifolius] XP_019434268.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial isoform X2 [Lupinus angustifolius] OIW21951.1 hypothetical protein TanjilG_16158 [Lupinus angustifolius] Length = 222 Score = 66.2 bits (160), Expect = 7e-11 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYERHFHEDLEDVRRKL IVP P V Sbjct: 190 CTDLMCVYYERHFHEDLEDVRRKLGIVPVPPV 221 >KHN26932.1 Ubiquinone biosynthesis protein COQ4 like, mitochondrial [Glycine soja] Length = 224 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 344 TDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 TDLMCVYYE+HFHEDLEDVRRKLQIVPAP V Sbjct: 193 TDLMCVYYEQHFHEDLEDVRRKLQIVPAPTV 223 >XP_006582901.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_006582903.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_006582905.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_006582907.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_006582908.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_014632828.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_014632829.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_014632830.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_014632831.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] XP_014632832.1 PREDICTED: uncharacterized protein LOC100787101 isoform X1 [Glycine max] KRH48070.1 hypothetical protein GLYMA_07G066700 [Glycine max] KRH48071.1 hypothetical protein GLYMA_07G066700 [Glycine max] KRH48072.1 hypothetical protein GLYMA_07G066700 [Glycine max] KRH48073.1 hypothetical protein GLYMA_07G066700 [Glycine max] Length = 224 Score = 65.9 bits (159), Expect = 1e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 344 TDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 TDLMCVYYE+HFHEDLEDVRRKLQIVPAP V Sbjct: 193 TDLMCVYYEQHFHEDLEDVRRKLQIVPAPTV 223 >XP_009356420.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Pyrus x bretschneideri] Length = 227 Score = 65.5 bits (158), Expect = 2e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPA 255 CTDLMCVYYERHFHEDLEDVRRK I+PAPA Sbjct: 192 CTDLMCVYYERHFHEDLEDVRRKWGIIPAPA 222 >XP_008367033.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Malus domestica] Length = 227 Score = 65.5 bits (158), Expect = 2e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPA 255 CTDLMCVYYERHFHEDLEDVRRK I+PAPA Sbjct: 192 CTDLMCVYYERHFHEDLEDVRRKWGIIPAPA 222 >XP_008243830.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Prunus mume] XP_008243831.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Prunus mume] Length = 227 Score = 65.5 bits (158), Expect = 2e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDLEDVRRK I+PAPAV Sbjct: 192 CTDLMCVYYEQHFHEDLEDVRRKWGIIPAPAV 223 >XP_007227569.1 hypothetical protein PRUPE_ppa010913mg [Prunus persica] XP_007227570.1 hypothetical protein PRUPE_ppa010913mg [Prunus persica] ONI31046.1 hypothetical protein PRUPE_1G288800 [Prunus persica] ONI31047.1 hypothetical protein PRUPE_1G288800 [Prunus persica] ONI31048.1 hypothetical protein PRUPE_1G288800 [Prunus persica] ONI31049.1 hypothetical protein PRUPE_1G288800 [Prunus persica] Length = 230 Score = 65.1 bits (157), Expect = 2e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMC+YYE+HFHEDLEDVRRK I+PAPAV Sbjct: 192 CTDLMCIYYEQHFHEDLEDVRRKWGIIPAPAV 223 >XP_004489686.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like [Cicer arietinum] XP_004489687.1 PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like [Cicer arietinum] Length = 224 Score = 64.7 bits (156), Expect = 3e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDLEDVRRKL IVP P V Sbjct: 192 CTDLMCVYYEQHFHEDLEDVRRKLGIVPVPPV 223 >KJB30479.1 hypothetical protein B456_005G145900 [Gossypium raimondii] Length = 163 Score = 63.5 bits (153), Expect = 3e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 347 CTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 252 CTDLMCVYYE+HFHEDLEDVRRK ++PAP V Sbjct: 130 CTDLMCVYYEQHFHEDLEDVRRKWGVIPAPTV 161