BLASTX nr result
ID: Glycyrrhiza31_contig00014816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014816 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016194594.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 55 5e-06 XP_015945208.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 55 5e-06 XP_016194585.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 55 5e-06 XP_015945204.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 55 5e-06 XP_016173851.1 PREDICTED: uncharacterized protein LOC107616404 [... 54 5e-06 XP_016194601.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 54 7e-06 XP_015945214.1 PREDICTED: protein CHUP1, chloroplastic isoform X... 54 7e-06 >XP_016194594.1 PREDICTED: protein CHUP1, chloroplastic isoform X2 [Arachis ipaensis] Length = 632 Score = 54.7 bits (130), Expect = 5e-06 Identities = 33/81 (40%), Positives = 41/81 (50%), Gaps = 12/81 (14%) Frame = -1 Query: 209 CPPLIFFSSFRTPHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVV 66 C + P+L E + MKQK P+ PTT RS L + H+D+ L Sbjct: 4 CSEIFIRKFLGRPNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSS 63 Query: 65 PPPPSRHRASSKARESPKTPP 3 P P +R R S KARESPKTPP Sbjct: 64 PSPTTRLRGSYKARESPKTPP 84 >XP_015945208.1 PREDICTED: protein CHUP1, chloroplastic isoform X2 [Arachis duranensis] Length = 632 Score = 54.7 bits (130), Expect = 5e-06 Identities = 33/81 (40%), Positives = 41/81 (50%), Gaps = 12/81 (14%) Frame = -1 Query: 209 CPPLIFFSSFRTPHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVV 66 C + P+L E + MKQK P+ PTT RS L + H+D+ L Sbjct: 4 CSEIFIRKFLGRPNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSS 63 Query: 65 PPPPSRHRASSKARESPKTPP 3 P P +R R S KARESPKTPP Sbjct: 64 PSPTTRLRGSYKARESPKTPP 84 >XP_016194585.1 PREDICTED: protein CHUP1, chloroplastic isoform X1 [Arachis ipaensis] Length = 633 Score = 54.7 bits (130), Expect = 5e-06 Identities = 33/81 (40%), Positives = 41/81 (50%), Gaps = 12/81 (14%) Frame = -1 Query: 209 CPPLIFFSSFRTPHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVV 66 C + P+L E + MKQK P+ PTT RS L + H+D+ L Sbjct: 4 CSEIFIRKFLGRPNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSS 63 Query: 65 PPPPSRHRASSKARESPKTPP 3 P P +R R S KARESPKTPP Sbjct: 64 PSPTTRLRGSYKARESPKTPP 84 >XP_015945204.1 PREDICTED: protein CHUP1, chloroplastic isoform X1 [Arachis duranensis] Length = 633 Score = 54.7 bits (130), Expect = 5e-06 Identities = 33/81 (40%), Positives = 41/81 (50%), Gaps = 12/81 (14%) Frame = -1 Query: 209 CPPLIFFSSFRTPHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVV 66 C + P+L E + MKQK P+ PTT RS L + H+D+ L Sbjct: 4 CSEIFIRKFLGRPNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSS 63 Query: 65 PPPPSRHRASSKARESPKTPP 3 P P +R R S KARESPKTPP Sbjct: 64 PSPTTRLRGSYKARESPKTPP 84 >XP_016173851.1 PREDICTED: uncharacterized protein LOC107616404 [Arachis ipaensis] Length = 277 Score = 54.3 bits (129), Expect = 5e-06 Identities = 32/69 (46%), Positives = 39/69 (56%), Gaps = 12/69 (17%) Frame = -1 Query: 173 PHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVVPPPPSRHRASSK 30 P+L E + MKQK P+ PTT RS L + H+D+ L P P +R R S K Sbjct: 4 PNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSSPSPTTRLRGSYK 63 Query: 29 ARESPKTPP 3 ARESPKTPP Sbjct: 64 ARESPKTPP 72 >XP_016194601.1 PREDICTED: protein CHUP1, chloroplastic isoform X3 [Arachis ipaensis] Length = 621 Score = 54.3 bits (129), Expect = 7e-06 Identities = 32/69 (46%), Positives = 39/69 (56%), Gaps = 12/69 (17%) Frame = -1 Query: 173 PHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVVPPPPSRHRASSK 30 P+L E + MKQK P+ PTT RS L + H+D+ L P P +R R S K Sbjct: 4 PNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSSPSPTTRLRGSYK 63 Query: 29 ARESPKTPP 3 ARESPKTPP Sbjct: 64 ARESPKTPP 72 >XP_015945214.1 PREDICTED: protein CHUP1, chloroplastic isoform X3 [Arachis duranensis] Length = 621 Score = 54.3 bits (129), Expect = 7e-06 Identities = 32/69 (46%), Positives = 39/69 (56%), Gaps = 12/69 (17%) Frame = -1 Query: 173 PHLRE-KAMKQKTTPT-----------PTTGRSVLKQHHSDKLLQGVVPPPPSRHRASSK 30 P+L E + MKQK P+ PTT RS L + H+D+ L P P +R R S K Sbjct: 4 PNLTETEIMKQKMPPSLSPSPPPPPSPPTTARSFLSKQHNDRSLHSSSPSPTTRLRGSYK 63 Query: 29 ARESPKTPP 3 ARESPKTPP Sbjct: 64 ARESPKTPP 72