BLASTX nr result
ID: Glycyrrhiza31_contig00014581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014581 (583 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004495624.1 PREDICTED: probable receptor-like protein kinase ... 68 6e-10 NP_001238381.1 receptor protein kinase [Glycine max] ACM89464.1 ... 62 2e-08 KYP40006.1 putative serine/threonine-protein kinase At1g01540 fa... 63 2e-08 KHN26187.1 Putative receptor-like protein kinase [Glycine soja] 62 5e-08 XP_006605287.1 PREDICTED: receptor protein kinase isoform X1 [Gl... 62 5e-08 XP_003536030.1 PREDICTED: probable receptor-like protein kinase ... 62 5e-08 KRH33761.1 hypothetical protein GLYMA_10G144200 [Glycine max] 62 5e-08 XP_007145035.1 hypothetical protein PHAVU_007G204300g [Phaseolus... 62 8e-08 XP_014514115.1 PREDICTED: probable receptor-like protein kinase ... 62 8e-08 XP_017415476.1 PREDICTED: probable receptor-like protein kinase ... 60 4e-07 KOM35430.1 hypothetical protein LR48_Vigan02g158000 [Vigna angul... 60 4e-07 XP_006428295.1 hypothetical protein CICLE_v100116732mg, partial ... 52 5e-06 XP_016175834.1 PREDICTED: probable receptor-like protein kinase ... 56 8e-06 >XP_004495624.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Cicer arietinum] Length = 505 Score = 67.8 bits (164), Expect = 6e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 PREDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSES 119 PREDRRLRRNRG S TEIESQKESSDTDGS+IQGS+SES Sbjct: 466 PREDRRLRRNRGGS-TEIESQKESSDTDGSDIQGSQSES 503 >NP_001238381.1 receptor protein kinase [Glycine max] ACM89464.1 receptor protein kinase [Glycine max] Length = 230 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRNRG +S EIES K++SDTDGS+IQGSRSESGR Sbjct: 192 REDRRHRRNRGVNS-EIESHKDNSDTDGSDIQGSRSESGR 230 >KYP40006.1 putative serine/threonine-protein kinase At1g01540 family [Cajanus cajan] Length = 509 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 3 PREDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 PREDRR RRNR +S EIESQK+ SDTDGS+IQGSRSESGR Sbjct: 470 PREDRRHRRNREVNS-EIESQKDCSDTDGSDIQGSRSESGR 509 >KHN26187.1 Putative receptor-like protein kinase [Glycine soja] Length = 506 Score = 62.4 bits (150), Expect = 5e-08 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRNRG +S EIES K++SDTDGS+IQGSRSESGR Sbjct: 468 REDRRHRRNRGVNS-EIESHKDNSDTDGSDIQGSRSESGR 506 >XP_006605287.1 PREDICTED: receptor protein kinase isoform X1 [Glycine max] XP_006605288.1 PREDICTED: receptor protein kinase isoform X1 [Glycine max] XP_014627693.1 PREDICTED: receptor protein kinase isoform X1 [Glycine max] KRG90473.1 hypothetical protein GLYMA_20G093200 [Glycine max] Length = 506 Score = 62.4 bits (150), Expect = 5e-08 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRNRG +S EIES K++SDTDGS+IQGSRSESGR Sbjct: 468 REDRRHRRNRGVNS-EIESHKDNSDTDGSDIQGSRSESGR 506 >XP_003536030.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Glycine max] KHN16029.1 Putative receptor-like protein kinase [Glycine soja] KRH33762.1 hypothetical protein GLYMA_10G144200 [Glycine max] Length = 506 Score = 62.4 bits (150), Expect = 5e-08 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRNRG +S EIES K++SDTDGS+IQGSRSESGR Sbjct: 468 REDRRHRRNRGVNS-EIESHKDNSDTDGSDIQGSRSESGR 506 >KRH33761.1 hypothetical protein GLYMA_10G144200 [Glycine max] Length = 515 Score = 62.4 bits (150), Expect = 5e-08 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRNRG +S EIES K++SDTDGS+IQGSRSESGR Sbjct: 477 REDRRHRRNRGVNS-EIESHKDNSDTDGSDIQGSRSESGR 515 >XP_007145035.1 hypothetical protein PHAVU_007G204300g [Phaseolus vulgaris] ESW17029.1 hypothetical protein PHAVU_007G204300g [Phaseolus vulgaris] Length = 506 Score = 61.6 bits (148), Expect = 8e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRN G +S EIES K+SSDTDGS+IQGSRSESGR Sbjct: 468 REDRRHRRNHGVNS-EIESHKDSSDTDGSDIQGSRSESGR 506 >XP_014514115.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Vigna radiata var. radiata] Length = 520 Score = 61.6 bits (148), Expect = 8e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RRN G +S EIES K+SSDTDGS+IQGSRSESGR Sbjct: 469 REDRRHRRNHGVNS-EIESHKDSSDTDGSDIQGSRSESGR 507 >XP_017415476.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Vigna angularis] BAT95156.1 hypothetical protein VIGAN_08182600 [Vigna angularis var. angularis] Length = 507 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RR+ G +S EIES K+SSDTDGS+IQGSRSESGR Sbjct: 469 REDRRHRRSHGVNS-EIESHKDSSDTDGSDIQGSRSESGR 507 >KOM35430.1 hypothetical protein LR48_Vigan02g158000 [Vigna angularis] Length = 524 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 6 REDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 REDRR RR+ G +S EIES K+SSDTDGS+IQGSRSESGR Sbjct: 473 REDRRHRRSHGVNS-EIESHKDSSDTDGSDIQGSRSESGR 511 >XP_006428295.1 hypothetical protein CICLE_v100116732mg, partial [Citrus clementina] ESR41535.1 hypothetical protein CICLE_v100116732mg, partial [Citrus clementina] Length = 39 Score = 51.6 bits (122), Expect = 5e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 12 DRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESGR 125 DRR RR +G +S EIESQKE+SDTD S+ GSRSES R Sbjct: 1 DRRHRRTQGGTSMEIESQKENSDTDRSDYPGSRSESKR 38 >XP_016175834.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Arachis ipaensis] Length = 509 Score = 55.8 bits (133), Expect = 8e-06 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +3 Query: 3 PREDRRLRRNRGASSTEIESQKESSDTDGSEIQGSRSESG 122 PREDRR RRN G +S EIESQK+ SDTD SEIQGS SESG Sbjct: 470 PREDRRQRRNCGNNS-EIESQKDHSDTDRSEIQGSVSESG 508