BLASTX nr result
ID: Glycyrrhiza31_contig00014526
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014526 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019444141.1 PREDICTED: serine/threonine-protein phosphatase P... 79 3e-15 XP_019444142.1 PREDICTED: serine/threonine-protein phosphatase P... 79 3e-15 XP_015969269.1 PREDICTED: serine/threonine-protein phosphatase P... 78 5e-15 XP_019425414.1 PREDICTED: serine/threonine-protein phosphatase P... 77 2e-14 XP_004494304.1 PREDICTED: serine/threonine-protein phosphatase P... 77 2e-14 XP_019425413.1 PREDICTED: serine/threonine-protein phosphatase P... 77 2e-14 XP_019455478.1 PREDICTED: serine/threonine-protein phosphatase P... 75 5e-14 XP_010524038.1 PREDICTED: serine/threonine-protein phosphatase P... 74 1e-13 KYP71645.1 Serine/threonine-protein phosphatase PP2A catalytic s... 74 2e-13 XP_006402781.1 hypothetical protein EUTSA_v10006109mg [Eutrema s... 74 2e-13 NP_001189732.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 71 3e-13 NP_001324022.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 71 3e-13 NP_001324021.1 protein phosphatase 2A-3 [Arabidopsis thaliana] A... 71 3e-13 XP_013591939.1 PREDICTED: serine/threonine-protein phosphatase P... 71 4e-13 XP_018482781.1 PREDICTED: serine/threonine-protein phosphatase P... 73 4e-13 XP_010550105.1 PREDICTED: serine/threonine-protein phosphatase P... 73 4e-13 KFK35108.1 hypothetical protein AALP_AA5G237100 [Arabis alpina] 73 4e-13 XP_018478095.1 PREDICTED: serine/threonine-protein phosphatase P... 73 4e-13 XP_018478094.1 PREDICTED: serine/threonine-protein phosphatase P... 73 5e-13 BAA92699.1 type 2A protein phosphatase-3 [Vicia faba] 73 5e-13 >XP_019444141.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X1 [Lupinus angustifolius] Length = 313 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLPSES+HDLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MGANSLPSESSHDLDEQISQLMQCKPLSEQQVKVLCEKAK 40 >XP_019444142.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Lupinus angustifolius] Length = 313 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLPSES+HDLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MGANSLPSESSHDLDEQISQLMQCKPLSEQQVKVLCEKAK 40 >XP_015969269.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Arachis duranensis] XP_016162934.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Arachis ipaensis] Length = 313 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLPS+STHDLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPSDSTHDLDEQISQLMQCKPLSEQQVRVLCEKAK 40 >XP_019425414.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like isoform X2 [Lupinus angustifolius] OIV92256.1 hypothetical protein TanjilG_00274 [Lupinus angustifolius] Length = 313 Score = 76.6 bits (187), Expect = 2e-14 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+PSE +HDLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MGANSIPSEGSHDLDEQISQLMQCKPLSEQQVKVLCEKAK 40 >XP_004494304.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Cicer arietinum] Length = 313 Score = 76.6 bits (187), Expect = 2e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+ +ESTHDLDEQISQLMQCKPLSEQQVK+LCEKAK Sbjct: 1 MGANSMLTESTHDLDEQISQLMQCKPLSEQQVKELCEKAK 40 >XP_019425413.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit-like isoform X1 [Lupinus angustifolius] Length = 323 Score = 76.6 bits (187), Expect = 2e-14 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+PSE +HDLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MGANSIPSEGSHDLDEQISQLMQCKPLSEQQVKVLCEKAK 40 >XP_019455478.1 PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Lupinus angustifolius] OIW05193.1 hypothetical protein TanjilG_19824 [Lupinus angustifolius] Length = 313 Score = 75.5 bits (184), Expect = 5e-14 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 M ANSLPS+S+HDLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MSANSLPSDSSHDLDEQISQLMQCKPLSEQQVKVLCEKAK 40 >XP_010524038.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Tarenaya hassleriana] Length = 313 Score = 74.3 bits (181), Expect = 1e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLP+EST DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPTESTLDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >KYP71645.1 Serine/threonine-protein phosphatase PP2A catalytic subunit [Cajanus cajan] Length = 313 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+ SES+HDLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSMLSESSHDLDEQISQLMQCKPLSEQQVRGLCEKAK 40 >XP_006402781.1 hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum] ESQ44234.1 hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum] Length = 313 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLP++ST DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPTDSTLDLDEQISQLMQCKPLSEQQVRSLCEKAK 40 >NP_001189732.1 protein phosphatase 2A-3 [Arabidopsis thaliana] AEC10129.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 171 Score = 71.2 bits (173), Expect = 3e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >NP_001324022.1 protein phosphatase 2A-3 [Arabidopsis thaliana] ANM61825.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 178 Score = 71.2 bits (173), Expect = 3e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >NP_001324021.1 protein phosphatase 2A-3 [Arabidopsis thaliana] ANM61824.1 protein phosphatase 2A-3 [Arabidopsis thaliana] Length = 180 Score = 71.2 bits (173), Expect = 3e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >XP_013591939.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Brassica oleracea var. oleracea] Length = 166 Score = 70.9 bits (172), Expect = 4e-13 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+++T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSVPADATLDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >XP_018482781.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like [Raphanus sativus] XP_018483637.1 PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit-like [Raphanus sativus] Length = 313 Score = 73.2 bits (178), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+E+T DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSIPTEATIDLDEQISQLMQCKPLSEQQVRSLCEKAK 40 >XP_010550105.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit isoform X1 [Tarenaya hassleriana] Length = 313 Score = 73.2 bits (178), Expect = 4e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLP++ST DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPTDSTLDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >KFK35108.1 hypothetical protein AALP_AA5G237100 [Arabis alpina] Length = 313 Score = 73.2 bits (178), Expect = 4e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANSLP++ST DLDEQISQLMQCKPLSEQQV+ LCEKAK Sbjct: 1 MGANSLPTDSTLDLDEQISQLMQCKPLSEQQVRALCEKAK 40 >XP_018478095.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Raphanus sativus] Length = 285 Score = 72.8 bits (177), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+++T DLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MGANSVPTDATIDLDEQISQLMQCKPLSEQQVKSLCEKAK 40 >XP_018478094.1 PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X1 [Raphanus sativus] Length = 313 Score = 72.8 bits (177), Expect = 5e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS+P+++T DLDEQISQLMQCKPLSEQQVK LCEKAK Sbjct: 1 MGANSVPTDATIDLDEQISQLMQCKPLSEQQVKSLCEKAK 40 >BAA92699.1 type 2A protein phosphatase-3 [Vicia faba] Length = 313 Score = 72.8 bits (177), Expect = 5e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +3 Query: 201 MGANSLPSESTHDLDEQISQLMQCKPLSEQQVKDLCEKAK 320 MGANS +ESTHDL+EQISQLMQCKPLSEQQVK+LCEKAK Sbjct: 1 MGANSNLAESTHDLNEQISQLMQCKPLSEQQVKELCEKAK 40