BLASTX nr result
ID: Glycyrrhiza31_contig00014369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014369 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003626213.2 transmembrane protein, putative [Medicago truncat... 61 1e-08 >XP_003626213.2 transmembrane protein, putative [Medicago truncatula] AES82431.2 transmembrane protein, putative [Medicago truncatula] Length = 223 Score = 61.2 bits (147), Expect = 1e-08 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = +3 Query: 246 LHRLGLS*RFGSRLHYHHLHVQHAYSALHSPYNHEGPNPLLREYWSTD*YNRVE 407 L R L R S L H + Q+ YSALHSP++HEG NPLL +YWSTD Y RVE Sbjct: 3 LCRFELKVRATSSLSIHFIPFQYDYSALHSPHHHEGSNPLLWKYWSTDNYYRVE 56