BLASTX nr result
ID: Glycyrrhiza31_contig00014209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014209 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074131827.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 87 8e-18 WP_038386675.1 hypothetical protein [Bradyrhizobium elkanii] 87 8e-18 WP_024584726.1 MULTISPECIES: chloride channel protein [Bradyrhiz... 88 1e-17 WP_029079758.1 chloride channel protein [Bradyrhizobium sp. th.b2] 87 2e-17 WP_028340354.1 chloride channel protein [Bradyrhizobium elkanii] 87 2e-17 WP_076865346.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 86 2e-17 SED88669.1 NHL repeat-containing protein [Bradyrhizobium erythro... 86 2e-17 WP_051346109.1 hypothetical protein [Bradyrhizobium sp. th.b2] 86 2e-17 WP_044538115.1 hypothetical protein [Bradyrhizobium sp. LTSP885]... 85 6e-17 WP_074128190.1 chloride channel protein [Bradyrhizobium sp. NAS9... 85 1e-16 SDC68155.1 chloride channel protein, CIC family [Bradyrhizobium ... 85 1e-16 WP_050403422.1 chloride channel protein [Bradyrhizobium embrapense] 85 1e-16 WP_050631957.1 chloride channel protein [Bradyrhizobium viridifu... 85 1e-16 WP_028333635.1 MULTISPECIES: chloride channel protein [Bradyrhiz... 85 1e-16 SDC68192.1 NHL repeat-containing protein [Bradyrhizobium sp. R5] 84 2e-16 WP_044587575.1 hypothetical protein [Bradyrhizobium sp. LTSPM299... 84 2e-16 WP_028340355.1 hypothetical protein [Bradyrhizobium elkanii] 83 2e-16 WP_076827407.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-... 83 3e-16 WP_069280217.1 hypothetical protein [Bradyrhizobium elkanii] ODM... 83 3e-16 WP_057017743.1 hypothetical protein [Bradyrhizobium pachyrhizi] ... 83 3e-16 >WP_074131827.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO67884.1 hypothetical protein AC628_37535 [Bradyrhizobium sp. NAS96.2] Length = 325 Score = 87.0 bits (214), Expect = 8e-18 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVTG 278 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLE+VTG Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLEKVTG 325 >WP_038386675.1 hypothetical protein [Bradyrhizobium elkanii] Length = 325 Score = 87.0 bits (214), Expect = 8e-18 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVTG 278 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLE+VTG Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLEKVTG 325 >WP_024584726.1 MULTISPECIES: chloride channel protein [Bradyrhizobium] KIU51043.1 chloride channel protein [Bradyrhizobium elkanii] OCX28125.1 chloride channel protein [Bradyrhizobium sp. UASWS1016] Length = 586 Score = 87.8 bits (216), Expect = 1e-17 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE Sbjct: 542 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 585 >WP_029079758.1 chloride channel protein [Bradyrhizobium sp. th.b2] Length = 586 Score = 87.4 bits (215), Expect = 2e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 585 >WP_028340354.1 chloride channel protein [Bradyrhizobium elkanii] Length = 586 Score = 87.4 bits (215), Expect = 2e-17 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 585 >WP_076865346.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 325 Score = 85.9 bits (211), Expect = 2e-17 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVTG 278 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERV G Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVMG 325 >SED88669.1 NHL repeat-containing protein [Bradyrhizobium erythrophlei] Length = 325 Score = 85.9 bits (211), Expect = 2e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT 281 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT 324 >WP_051346109.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 336 Score = 85.9 bits (211), Expect = 2e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT 281 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT 324 >WP_044538115.1 hypothetical protein [Bradyrhizobium sp. LTSP885] KJC47092.1 hypothetical protein UP09_10670 [Bradyrhizobium sp. LTSP885] Length = 325 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT 281 RGDIYVGEVGVTDWKTSFPDTEMPA+VRVTRCLQKLERVT Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPASVRVTRCLQKLERVT 324 >WP_074128190.1 chloride channel protein [Bradyrhizobium sp. NAS96.2] OKO76471.1 chloride channel protein [Bradyrhizobium sp. NAS96.2] Length = 586 Score = 85.1 bits (209), Expect = 1e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESE RRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESEQRRREVIGE 585 >SDC68155.1 chloride channel protein, CIC family [Bradyrhizobium sp. R5] Length = 586 Score = 85.1 bits (209), Expect = 1e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESE RRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESEQRRREVIGE 585 >WP_050403422.1 chloride channel protein [Bradyrhizobium embrapense] Length = 586 Score = 85.1 bits (209), Expect = 1e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESE RRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESEQRRREVIGE 585 >WP_050631957.1 chloride channel protein [Bradyrhizobium viridifuturi] Length = 586 Score = 85.1 bits (209), Expect = 1e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESE RRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESEQRRREVIGE 585 >WP_028333635.1 MULTISPECIES: chloride channel protein [Bradyrhizobium] Length = 586 Score = 85.1 bits (209), Expect = 1e-16 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +1 Query: 4 AEAESLAVIEGDGDRRPIGLLTEAHAMRRYAEESELRRREVIGE 135 AEAESLAV+EGDGDRRPIGLLTEAHAMRRYAEESE RRREVIGE Sbjct: 542 AEAESLAVVEGDGDRRPIGLLTEAHAMRRYAEESEQRRREVIGE 585 >SDC68192.1 NHL repeat-containing protein [Bradyrhizobium sp. R5] Length = 325 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERV 284 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLER+ Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERI 323 >WP_044587575.1 hypothetical protein [Bradyrhizobium sp. LTSPM299] KJC60640.1 hypothetical protein UP10_12215 [Bradyrhizobium sp. LTSPM299] Length = 325 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVT 281 RGDIYVGEVGVTDWKTSFPDTEMPA+VRVTRCLQKLE+VT Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPASVRVTRCLQKLEKVT 324 >WP_028340355.1 hypothetical protein [Bradyrhizobium elkanii] Length = 325 Score = 83.2 bits (204), Expect = 2e-16 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERVTG 278 RGDIYVGEVGVTDWKTSFPD EMPAAVRVTRCLQKLE VTG Sbjct: 285 RGDIYVGEVGVTDWKTSFPDIEMPAAVRVTRCLQKLELVTG 325 >WP_076827407.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-321] OMI10660.1 hypothetical protein BSN85_14615 [Bradyrhizobium sp. UFLA 03-321] Length = 323 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERV 284 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLE+V Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLEKV 323 >WP_069280217.1 hypothetical protein [Bradyrhizobium elkanii] ODM70620.1 hypothetical protein A6X20_08520 [Bradyrhizobium elkanii] ODM80058.1 hypothetical protein A6452_24985 [Bradyrhizobium elkanii] Length = 323 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERV 284 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLE+V Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLEKV 323 >WP_057017743.1 hypothetical protein [Bradyrhizobium pachyrhizi] KRQ02292.1 hypothetical protein AOQ73_17890 [Bradyrhizobium pachyrhizi] Length = 323 Score = 82.8 bits (203), Expect = 3e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 400 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLERV 284 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLE+V Sbjct: 285 RGDIYVGEVGVTDWKTSFPDTEMPAAVRVTRCLQKLEKV 323