BLASTX nr result
ID: Glycyrrhiza31_contig00014142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00014142 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK43452.1 unknown [Lotus japonicus] 157 6e-46 XP_007144460.1 hypothetical protein PHAVU_007G158000g, partial [... 162 3e-45 KYP74111.1 hypothetical protein KK1_006779 [Cajanus cajan] 161 4e-45 KHN48990.1 Arginine biosynthesis bifunctional protein ArgJ, chlo... 161 4e-45 XP_003542466.1 PREDICTED: arginine biosynthesis bifunctional pro... 161 4e-45 KOM35259.1 hypothetical protein LR48_Vigan02g140900 [Vigna angul... 161 5e-45 XP_017412451.1 PREDICTED: arginine biosynthesis bifunctional pro... 161 6e-45 XP_013468329.1 arginine biosynthesis protein ArgJ [Medicago trun... 160 1e-44 GAU48080.1 hypothetical protein TSUD_81400 [Trifolium subterraneum] 160 1e-44 XP_004495013.1 PREDICTED: arginine biosynthesis bifunctional pro... 159 5e-44 XP_014512517.1 PREDICTED: arginine biosynthesis bifunctional pro... 158 9e-44 XP_006588728.1 PREDICTED: arginine biosynthesis bifunctional pro... 157 1e-43 KHN05924.1 Arginine biosynthesis bifunctional protein ArgJ, chlo... 157 2e-43 XP_003537190.1 PREDICTED: arginine biosynthesis bifunctional pro... 157 2e-43 XP_019440953.1 PREDICTED: arginine biosynthesis bifunctional pro... 155 7e-43 XP_019440952.1 PREDICTED: arginine biosynthesis bifunctional pro... 155 1e-42 XP_015949111.1 PREDICTED: arginine biosynthesis bifunctional pro... 147 1e-39 XP_010088057.1 Arginine biosynthesis bifunctional protein ArgJ [... 145 1e-39 XP_008241426.1 PREDICTED: arginine biosynthesis bifunctional pro... 145 5e-39 XP_008241418.1 PREDICTED: arginine biosynthesis bifunctional pro... 145 6e-39 >AFK43452.1 unknown [Lotus japonicus] Length = 233 Score = 157 bits (398), Expect = 6e-46 Identities = 75/82 (91%), Positives = 79/82 (96%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSF+QNLLRVELGDILLMDGGEPQ FDR AASSYL++AGE+HGTVRIQISVGNGPG Sbjct: 152 GYSGVSFNQNLLRVELGDILLMDGGEPQSFDRDAASSYLKRAGESHGTVRIQISVGNGPG 211 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYTS Sbjct: 212 SGQAWGCDLSYDYVKINAEYTS 233 >XP_007144460.1 hypothetical protein PHAVU_007G158000g, partial [Phaseolus vulgaris] ESW16454.1 hypothetical protein PHAVU_007G158000g, partial [Phaseolus vulgaris] Length = 506 Score = 162 bits (411), Expect = 3e-45 Identities = 78/82 (95%), Positives = 80/82 (97%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLMDGGEPQLFDR AASSYLRKAGETH TVRIQISVGNGPG Sbjct: 425 GYSGVSFHQDLLRVELGDILLMDGGEPQLFDRHAASSYLRKAGETHDTVRIQISVGNGPG 484 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 485 RGQAWGCDLSYDYVKINAEYTT 506 >KYP74111.1 hypothetical protein KK1_006779 [Cajanus cajan] Length = 442 Score = 161 bits (407), Expect = 4e-45 Identities = 77/82 (93%), Positives = 79/82 (96%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+ LRVELGDILLMDGGEPQLFDR AASSYLRKAGETH TVRIQISVGNGPG Sbjct: 361 GYSGVSFHQDSLRVELGDILLMDGGEPQLFDRNAASSYLRKAGETHDTVRIQISVGNGPG 420 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 421 RGQAWGCDLSYDYVKINAEYTT 442 >KHN48990.1 Arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Glycine soja] Length = 462 Score = 161 bits (408), Expect = 4e-45 Identities = 77/82 (93%), Positives = 80/82 (97%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLMDGGEPQLFDR AASSYLRKAGETH TV+IQISVGNGPG Sbjct: 381 GYSGVSFHQDLLRVELGDILLMDGGEPQLFDRHAASSYLRKAGETHDTVKIQISVGNGPG 440 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 441 RGQAWGCDLSYDYVKINAEYTT 462 >XP_003542466.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like [Glycine max] KRH19717.1 hypothetical protein GLYMA_13G131900 [Glycine max] Length = 464 Score = 161 bits (408), Expect = 4e-45 Identities = 77/82 (93%), Positives = 80/82 (97%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLMDGGEPQLFDR AASSYLRKAGETH TV+IQISVGNGPG Sbjct: 383 GYSGVSFHQDLLRVELGDILLMDGGEPQLFDRHAASSYLRKAGETHDTVKIQISVGNGPG 442 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 443 RGQAWGCDLSYDYVKINAEYTT 464 >KOM35259.1 hypothetical protein LR48_Vigan02g140900 [Vigna angularis] Length = 454 Score = 161 bits (407), Expect = 5e-45 Identities = 77/82 (93%), Positives = 80/82 (97%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLM+GGEPQLFDR AASSYLRKAGETH TVRIQISVGNGPG Sbjct: 373 GYSGVSFHQDLLRVELGDILLMEGGEPQLFDRHAASSYLRKAGETHDTVRIQISVGNGPG 432 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 433 RGQAWGCDLSYDYVKINAEYTT 454 >XP_017412451.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Vigna angularis] BAT95381.1 hypothetical protein VIGAN_08209200 [Vigna angularis var. angularis] Length = 464 Score = 161 bits (407), Expect = 6e-45 Identities = 77/82 (93%), Positives = 80/82 (97%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLM+GGEPQLFDR AASSYLRKAGETH TVRIQISVGNGPG Sbjct: 383 GYSGVSFHQDLLRVELGDILLMEGGEPQLFDRHAASSYLRKAGETHDTVRIQISVGNGPG 442 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 443 RGQAWGCDLSYDYVKINAEYTT 464 >XP_013468329.1 arginine biosynthesis protein ArgJ [Medicago truncatula] KEH42366.1 arginine biosynthesis protein ArgJ [Medicago truncatula] Length = 470 Score = 160 bits (405), Expect = 1e-44 Identities = 76/82 (92%), Positives = 78/82 (95%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSF+QNLLRVELGD LLMDGGEPQ FDRG ASSYLRKAGETHGTVRIQIS+GNGPG Sbjct: 389 GYSGVSFNQNLLRVELGDTLLMDGGEPQSFDRGEASSYLRKAGETHGTVRIQISIGNGPG 448 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYTS Sbjct: 449 HGQAWGCDLSYDYVKINAEYTS 470 >GAU48080.1 hypothetical protein TSUD_81400 [Trifolium subterraneum] Length = 473 Score = 160 bits (405), Expect = 1e-44 Identities = 76/82 (92%), Positives = 79/82 (96%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSF+QNLLRVELGD LLMDGGEPQ FDRGAASSYLRKAGETHGTVRIQIS+G+GPG Sbjct: 392 GYSGVSFNQNLLRVELGDTLLMDGGEPQSFDRGAASSYLRKAGETHGTVRIQISIGDGPG 451 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYTS Sbjct: 452 HGQAWGCDLSYDYVKINAEYTS 473 >XP_004495013.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Cicer arietinum] Length = 467 Score = 159 bits (401), Expect = 5e-44 Identities = 74/82 (90%), Positives = 79/82 (96%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGV+FHQNLLRVELG+ILLMDGGEPQ FDRG ASSYLR AGETHGTV+IQIS+GNGPG Sbjct: 386 GYSGVAFHQNLLRVELGNILLMDGGEPQSFDRGEASSYLRTAGETHGTVKIQISIGNGPG 445 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 +GQAWGCDLSYDYVKINAEYTS Sbjct: 446 QGQAWGCDLSYDYVKINAEYTS 467 >XP_014512517.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Vigna radiata var. radiata] Length = 464 Score = 158 bits (399), Expect = 9e-44 Identities = 75/82 (91%), Positives = 79/82 (96%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDI+LM+GGEPQLFDR AASSYLRKAGE H TVRIQISVGNGPG Sbjct: 383 GYSGVSFHQDLLRVELGDIVLMEGGEPQLFDRHAASSYLRKAGEAHDTVRIQISVGNGPG 442 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 443 RGQAWGCDLSYDYVKINAEYTT 464 >XP_006588728.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X2 [Glycine max] Length = 455 Score = 157 bits (397), Expect = 1e-43 Identities = 75/82 (91%), Positives = 78/82 (95%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLMDGGEPQLFDR ASSYLR+AGETH TVRIQISVGNGPG Sbjct: 374 GYSGVSFHQDLLRVELGDILLMDGGEPQLFDRDVASSYLRRAGETHDTVRIQISVGNGPG 433 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYT+ Sbjct: 434 CGQAWGCDLSYDYVKINAEYTT 455 >KHN05924.1 Arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Glycine soja] Length = 458 Score = 157 bits (397), Expect = 2e-43 Identities = 75/82 (91%), Positives = 78/82 (95%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLMDGGEPQLFDR ASSYLR+AGETH TVRIQISVGNGPG Sbjct: 377 GYSGVSFHQDLLRVELGDILLMDGGEPQLFDRDVASSYLRRAGETHDTVRIQISVGNGPG 436 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYT+ Sbjct: 437 CGQAWGCDLSYDYVKINAEYTT 458 >XP_003537190.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic-like isoform X1 [Glycine max] KRH32314.1 hypothetical protein GLYMA_10G044300 [Glycine max] Length = 460 Score = 157 bits (397), Expect = 2e-43 Identities = 75/82 (91%), Positives = 78/82 (95%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQ+LLRVELGDILLMDGGEPQLFDR ASSYLR+AGETH TVRIQISVGNGPG Sbjct: 379 GYSGVSFHQDLLRVELGDILLMDGGEPQLFDRDVASSYLRRAGETHDTVRIQISVGNGPG 438 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYT+ Sbjct: 439 CGQAWGCDLSYDYVKINAEYTT 460 >XP_019440953.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X2 [Lupinus angustifolius] Length = 443 Score = 155 bits (392), Expect = 7e-43 Identities = 73/82 (89%), Positives = 78/82 (95%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGV FHQ+LLRVELGDILLMDGGEPQ FDR AAS+YLRKAG+TH TVRIQIS+GNGPG Sbjct: 362 GYSGVPFHQSLLRVELGDILLMDGGEPQSFDRVAASNYLRKAGDTHDTVRIQISIGNGPG 421 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 422 RGQAWGCDLSYDYVKINAEYTT 443 >XP_019440952.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X1 [Lupinus angustifolius] Length = 472 Score = 155 bits (392), Expect = 1e-42 Identities = 73/82 (89%), Positives = 78/82 (95%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGV FHQ+LLRVELGDILLMDGGEPQ FDR AAS+YLRKAG+TH TVRIQIS+GNGPG Sbjct: 391 GYSGVPFHQSLLRVELGDILLMDGGEPQSFDRVAASNYLRKAGDTHDTVRIQISIGNGPG 450 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 451 RGQAWGCDLSYDYVKINAEYTT 472 >XP_015949111.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic [Arachis duranensis] Length = 470 Score = 147 bits (371), Expect = 1e-39 Identities = 70/82 (85%), Positives = 75/82 (91%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GYSGVSFHQN LRVELGDILLM GGEPQ FDR AAS+YL++AGETHGTVRI IS+GNG G Sbjct: 389 GYSGVSFHQNKLRVELGDILLMVGGEPQSFDRVAASNYLKRAGETHGTVRINISIGNGLG 448 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 GQAWGCDLSYDYVKINAEYT+ Sbjct: 449 HGQAWGCDLSYDYVKINAEYTT 470 >XP_010088057.1 Arginine biosynthesis bifunctional protein ArgJ [Morus notabilis] EXB31276.1 Arginine biosynthesis bifunctional protein ArgJ [Morus notabilis] Length = 382 Score = 145 bits (366), Expect = 1e-39 Identities = 67/82 (81%), Positives = 76/82 (92%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GY+G+SF Q LRV LGDILLMDGGEPQLFDR AAS+YL+K+GETHGTV I++SVG+GPG Sbjct: 301 GYAGISFDQKKLRVLLGDILLMDGGEPQLFDRAAASAYLKKSGETHGTVDIKVSVGDGPG 360 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 361 RGQAWGCDLSYDYVKINAEYTT 382 >XP_008241426.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X2 [Prunus mume] Length = 450 Score = 145 bits (366), Expect = 5e-39 Identities = 68/82 (82%), Positives = 74/82 (90%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GY+G+SF Q LRV LGDILLMDGGEPQLFDRGAAS YL+KAGE HGTV I +SVG+GPG Sbjct: 369 GYAGISFDQTKLRVLLGDILLMDGGEPQLFDRGAASDYLKKAGEIHGTVVINVSVGDGPG 428 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 429 RGQAWGCDLSYDYVKINAEYTT 450 >XP_008241418.1 PREDICTED: arginine biosynthesis bifunctional protein ArgJ, chloroplastic isoform X1 [Prunus mume] Length = 463 Score = 145 bits (366), Expect = 6e-39 Identities = 68/82 (82%), Positives = 74/82 (90%) Frame = -2 Query: 407 GYSGVSFHQNLLRVELGDILLMDGGEPQLFDRGAASSYLRKAGETHGTVRIQISVGNGPG 228 GY+G+SF Q LRV LGDILLMDGGEPQLFDRGAAS YL+KAGE HGTV I +SVG+GPG Sbjct: 382 GYAGISFDQTKLRVLLGDILLMDGGEPQLFDRGAASDYLKKAGEIHGTVVINVSVGDGPG 441 Query: 227 RGQAWGCDLSYDYVKINAEYTS 162 RGQAWGCDLSYDYVKINAEYT+ Sbjct: 442 RGQAWGCDLSYDYVKINAEYTT 463