BLASTX nr result
ID: Glycyrrhiza31_contig00013696
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00013696 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015954860.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 79 2e-14 XP_016184988.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 77 1e-13 XP_016184970.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 70 2e-11 XP_015949091.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 70 3e-11 XP_006573582.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 69 4e-11 XP_003517230.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 69 4e-11 KHN36119.1 U1 small nuclear ribonucleoprotein 70 kDa [Glycine soja] 69 4e-11 KOM45136.1 hypothetical protein LR48_Vigan06g044200 [Vigna angul... 67 2e-10 XP_017427401.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 67 2e-10 BAU00094.1 hypothetical protein VIGAN_10166000 [Vigna angularis ... 67 2e-10 XP_014520848.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 66 7e-10 XP_007156931.1 hypothetical protein PHAVU_002G029300g [Phaseolus... 66 7e-10 KRH28660.1 hypothetical protein GLYMA_11G067300 [Glycine max] 66 7e-10 XP_003537575.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 66 7e-10 XP_006590685.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 66 7e-10 XP_003629469.1 U1 small nuclear ribonucleoprotein 70 kDa protein... 65 1e-09 KYP34372.1 U1 small nuclear ribonucleoprotein 70 kDa [Cajanus ca... 65 2e-09 GAU39998.1 hypothetical protein TSUD_211190, partial [Trifolium ... 63 6e-09 BAE71300.1 putative U1 snRNP 70K protein [Trifolium pratense] 63 6e-09 XP_012573705.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 60 7e-08 >XP_015954860.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis duranensis] XP_015954864.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis duranensis] Length = 499 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDDC TERATSE RE+E NRDMDREYRR+ERSHSREYDY Sbjct: 459 RMEDDCPTERATSEPRERERNRDMDREYRRSERSHSREYDY 499 >XP_016184988.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis ipaensis] XP_016184994.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis ipaensis] Length = 497 Score = 76.6 bits (187), Expect = 1e-13 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDDC TERATSE E+E NRDMDREYRR+ERSHSREYDY Sbjct: 457 RMEDDCPTERATSEPHERERNRDMDREYRRSERSHSREYDY 497 >XP_016184970.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis ipaensis] XP_016184977.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis ipaensis] Length = 499 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD TERATSESRE+E NRD+DREY R+ RSHSREYDY Sbjct: 459 RMEDDYPTERATSESRERERNRDVDREYHRSVRSHSREYDY 499 >XP_015949091.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis duranensis] XP_015955291.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Arachis duranensis] Length = 499 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD TERATSE RE+E NRDMDREY R+ RSHSREYDY Sbjct: 459 RMEDDYPTERATSEPRERERNRDMDREYHRSVRSHSREYDY 499 >XP_006573582.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa isoform X2 [Glycine max] Length = 479 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + D+DREYRR+ERSHSREYDY Sbjct: 439 RMEDDYHAGRATSESHEKERSHDVDREYRRSERSHSREYDY 479 >XP_003517230.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa isoform X1 [Glycine max] KRH76798.1 hypothetical protein GLYMA_01G175100 [Glycine max] Length = 481 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + D+DREYRR+ERSHSREYDY Sbjct: 441 RMEDDYHAGRATSESHEKERSHDVDREYRRSERSHSREYDY 481 >KHN36119.1 U1 small nuclear ribonucleoprotein 70 kDa [Glycine soja] Length = 503 Score = 69.3 bits (168), Expect = 4e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + D+DREYRR+ERSHSREYDY Sbjct: 463 RMEDDYHAGRATSESHEKERSHDVDREYRRSERSHSREYDY 503 >KOM45136.1 hypothetical protein LR48_Vigan06g044200 [Vigna angularis] Length = 424 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + DREYRRTERSHSREYDY Sbjct: 384 RMEDDYHVGRATSESHEKEKSHGTDREYRRTERSHSREYDY 424 >XP_017427401.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Vigna angularis] Length = 475 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + DREYRRTERSHSREYDY Sbjct: 435 RMEDDYHVGRATSESHEKEKSHGTDREYRRTERSHSREYDY 475 >BAU00094.1 hypothetical protein VIGAN_10166000 [Vigna angularis var. angularis] Length = 475 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + DREYRRTERSHSREYDY Sbjct: 435 RMEDDYHVGRATSESHEKEKSHGTDREYRRTERSHSREYDY 475 >XP_014520848.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Vigna radiata var. radiata] Length = 476 Score = 65.9 bits (159), Expect = 7e-10 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + DREYRR+ERSHSREYDY Sbjct: 436 RMEDDYHVGRATSESHEKEKSHGTDREYRRSERSHSREYDY 476 >XP_007156931.1 hypothetical protein PHAVU_002G029300g [Phaseolus vulgaris] ESW28925.1 hypothetical protein PHAVU_002G029300g [Phaseolus vulgaris] Length = 478 Score = 65.9 bits (159), Expect = 7e-10 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD H RATSES EKE + DREYRR+ERSHSREYDY Sbjct: 438 RMEDDYHAGRATSESHEKEKSHGTDREYRRSERSHSREYDY 478 >KRH28660.1 hypothetical protein GLYMA_11G067300 [Glycine max] Length = 480 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 361 MEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 MEDD H RATSES EKE + D+DREY+R+ERSHSREYDY Sbjct: 441 MEDDYHAGRATSESHEKERSHDVDREYQRSERSHSREYDY 480 >XP_003537575.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa isoform X2 [Glycine max] KHN41987.1 U1 small nuclear ribonucleoprotein 70 kDa [Glycine soja] KRH28659.1 hypothetical protein GLYMA_11G067300 [Glycine max] Length = 482 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 361 MEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 MEDD H RATSES EKE + D+DREY+R+ERSHSREYDY Sbjct: 443 MEDDYHAGRATSESHEKERSHDVDREYQRSERSHSREYDY 482 >XP_006590685.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa isoform X1 [Glycine max] Length = 485 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 361 MEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 MEDD H RATSES EKE + D+DREY+R+ERSHSREYDY Sbjct: 446 MEDDYHAGRATSESHEKERSHDVDREYQRSERSHSREYDY 485 >XP_003629469.1 U1 small nuclear ribonucleoprotein 70 kDa protein, putative [Medicago truncatula] AET03945.1 U1 small nuclear ribonucleoprotein 70 kDa protein, putative [Medicago truncatula] Length = 502 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 +MEDD HTERA S+SR+++ NRD D +Y R+ERSHSREYDY Sbjct: 462 KMEDDHHTERAKSKSRDRDRNRDKDHDYHRSERSHSREYDY 502 >KYP34372.1 U1 small nuclear ribonucleoprotein 70 kDa [Cajanus cajan] Length = 492 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 RMEDD HTERATSES+++E +RD++ +Y R+ERSHSR YDY Sbjct: 452 RMEDDYHTERATSESQDRERSRDIEHQYHRSERSHSRGYDY 492 >GAU39998.1 hypothetical protein TSUD_211190, partial [Trifolium subterraneum] Length = 483 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 +MEDD HTER S+SR+++ NRD D +Y R+ERSHSREYDY Sbjct: 443 KMEDDHHTERPKSKSRDRDRNRDKDHDYHRSERSHSREYDY 483 >BAE71300.1 putative U1 snRNP 70K protein [Trifolium pratense] Length = 506 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 +MEDD HTER S+SR+++ NRD D +Y R+ERSHSREYDY Sbjct: 466 KMEDDHHTERPKSKSRDRDRNRDKDHDYHRSERSHSREYDY 506 >XP_012573705.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Cicer arietinum] Length = 512 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 364 RMEDDCHTERATSESREKEINRDMDREYRRTERSHSREYDY 242 + EDD HTER S+SRE++ NRD DR++ R+ RSHSREYDY Sbjct: 472 KTEDDHHTERTKSKSRERDRNRDTDRDHHRSARSHSREYDY 512