BLASTX nr result
ID: Glycyrrhiza31_contig00013097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00013097 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016187959.1 PREDICTED: conserved oligomeric Golgi complex sub... 94 2e-19 XP_015952891.1 PREDICTED: conserved oligomeric Golgi complex sub... 94 2e-19 XP_007131467.1 hypothetical protein PHAVU_011G016000g [Phaseolus... 91 1e-18 KHN46499.1 Conserved oligomeric Golgi complex subunit 7 [Glycine... 91 2e-18 KHN11738.1 Conserved oligomeric Golgi complex subunit 7 [Glycine... 91 2e-18 XP_003534367.1 PREDICTED: conserved oligomeric Golgi complex sub... 91 2e-18 XP_019450859.1 PREDICTED: conserved oligomeric Golgi complex sub... 89 5e-18 AIU51138.1 embryo yellow protein, partial [Phaseolus vulgaris] 89 5e-18 KYP68111.1 hypothetical protein KK1_021729 [Cajanus cajan] 89 5e-18 AIU51119.1 embryo yellow protein, partial [Glycine max] 89 7e-18 XP_004506344.1 PREDICTED: conserved oligomeric Golgi complex sub... 89 7e-18 XP_003618197.1 oligomeric component-related/COG complex componen... 88 1e-17 XP_017433377.1 PREDICTED: conserved oligomeric Golgi complex sub... 87 2e-17 XP_014522684.1 PREDICTED: conserved oligomeric Golgi complex sub... 87 2e-17 XP_013443607.1 oligomeric component-related/COG complex componen... 87 4e-17 XP_003618191.1 oligomeric component-related/COG complex componen... 86 8e-17 OMO98121.1 Conserved oligomeric Golgi complex subunit 7 [Corchor... 85 2e-16 AIU51139.1 embryo yellow protein, partial [Artemisia annua] 79 2e-16 OMO94890.1 Oligomeric Golgi complex component [Corchorus capsula... 85 2e-16 XP_016721195.1 PREDICTED: conserved oligomeric Golgi complex sub... 85 2e-16 >XP_016187959.1 PREDICTED: conserved oligomeric Golgi complex subunit 7 [Arachis ipaensis] Length = 832 Score = 93.6 bits (231), Expect = 2e-19 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTDQLDVPTANLVCKMRRVNLDS 158 +ALSMPIP VLATFQSCLSASRD+LKDLLK+D +D+PTANLVCKMRRVNLDS Sbjct: 781 SALSMPIPAVLATFQSCLSASRDQLKDLLKSDSVDMPTANLVCKMRRVNLDS 832 >XP_015952891.1 PREDICTED: conserved oligomeric Golgi complex subunit 7 [Arachis duranensis] Length = 832 Score = 93.6 bits (231), Expect = 2e-19 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTDQLDVPTANLVCKMRRVNLDS 158 +ALSMPIP VLATFQSCLSASRD+LKDLLK+D +D+PTANLVCKMRRVNLDS Sbjct: 781 SALSMPIPAVLATFQSCLSASRDQLKDLLKSDSVDMPTANLVCKMRRVNLDS 832 >XP_007131467.1 hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris] ESW03461.1 hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris] Length = 834 Score = 90.9 bits (224), Expect = 1e-18 Identities = 46/55 (83%), Positives = 51/55 (92%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS+ R++LKDLLKTD QLD+PTANLVCKMRRVNLDS Sbjct: 780 SALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLDS 834 >KHN46499.1 Conserved oligomeric Golgi complex subunit 7 [Glycine soja] Length = 834 Score = 90.5 bits (223), Expect = 2e-18 Identities = 46/55 (83%), Positives = 50/55 (90%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS R++LKDLLKTD QLD+PTANLVCKMRRVNLDS Sbjct: 780 SALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLDS 834 >KHN11738.1 Conserved oligomeric Golgi complex subunit 7 [Glycine soja] Length = 834 Score = 90.5 bits (223), Expect = 2e-18 Identities = 46/55 (83%), Positives = 50/55 (90%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS R++LKDLLKTD QLD+PTANLVCKMRRVNLDS Sbjct: 780 SALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLDS 834 >XP_003534367.1 PREDICTED: conserved oligomeric Golgi complex subunit 7-like [Glycine max] KRH39845.1 hypothetical protein GLYMA_09G224000 [Glycine max] Length = 834 Score = 90.5 bits (223), Expect = 2e-18 Identities = 46/55 (83%), Positives = 50/55 (90%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS R++LKDLLKTD QLD+PTANLVCKMRRVNLDS Sbjct: 780 SALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLDS 834 >XP_019450859.1 PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lupinus angustifolius] OIW08788.1 hypothetical protein TanjilG_16369 [Lupinus angustifolius] Length = 826 Score = 89.4 bits (220), Expect = 5e-18 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 2/54 (3%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKT--DQLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQ+CLS SR++LKDLLKT DQLD+PTANLVCK+RR+NLDS Sbjct: 773 SALSMPIPPVLATFQTCLSTSREQLKDLLKTDSDQLDLPTANLVCKIRRLNLDS 826 >AIU51138.1 embryo yellow protein, partial [Phaseolus vulgaris] Length = 833 Score = 89.4 bits (220), Expect = 5e-18 Identities = 45/54 (83%), Positives = 50/54 (92%), Gaps = 3/54 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLD 155 +ALSMPIPPVLATFQSCLS+ R++LKDLLKTD QLD+PTANLVCKMRRVNLD Sbjct: 780 SALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNLD 833 >KYP68111.1 hypothetical protein KK1_021729 [Cajanus cajan] Length = 834 Score = 89.4 bits (220), Expect = 5e-18 Identities = 45/55 (81%), Positives = 50/55 (90%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS R++LKDLLKTD QLD+PTANLVCKMRR+NLDS Sbjct: 780 SALSMPIPPVLATFQSCLSTPRNQLKDLLKTDPANQLDLPTANLVCKMRRLNLDS 834 >AIU51119.1 embryo yellow protein, partial [Glycine max] Length = 833 Score = 89.0 bits (219), Expect = 7e-18 Identities = 45/54 (83%), Positives = 49/54 (90%), Gaps = 3/54 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLD 155 +ALSMPIPPVLATFQSCLS R++LKDLLKTD QLD+PTANLVCKMRRVNLD Sbjct: 780 SALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNLD 833 >XP_004506344.1 PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cicer arietinum] Length = 835 Score = 89.0 bits (219), Expect = 7e-18 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 4/56 (7%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKT----DQLDVPTANLVCKMRRVNLDS 158 +ALSMPIP VLATFQSCLS SRD+LKDLLKT +QLD+PTANLVCKMRRVNLDS Sbjct: 780 SALSMPIPAVLATFQSCLSTSRDQLKDLLKTPDSANQLDLPTANLVCKMRRVNLDS 835 >XP_003618197.1 oligomeric component-related/COG complex component [Medicago truncatula] AES74415.1 oligomeric component-related/COG complex component [Medicago truncatula] Length = 755 Score = 88.2 bits (217), Expect = 1e-17 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIP VLATF SCLS SRD+LKDL+KTD QLD+PTANLVCKMRRVNLDS Sbjct: 701 SALSMPIPAVLATFHSCLSTSRDQLKDLVKTDSANQLDLPTANLVCKMRRVNLDS 755 >XP_017433377.1 PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vigna angularis] BAT91246.1 hypothetical protein VIGAN_06256100 [Vigna angularis var. angularis] Length = 833 Score = 87.4 bits (215), Expect = 2e-17 Identities = 44/55 (80%), Positives = 50/55 (90%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS+ R++L+DLLKTD LD+PTANLVCKMRRVNLDS Sbjct: 779 SALSMPIPPVLATFQSCLSSPRNQLQDLLKTDSGNHLDMPTANLVCKMRRVNLDS 833 >XP_014522684.1 PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vigna radiata var. radiata] Length = 833 Score = 87.4 bits (215), Expect = 2e-17 Identities = 44/55 (80%), Positives = 50/55 (90%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIPPVLATFQSCLS+ R++L+DLLKTD LD+PTANLVCKMRRVNLDS Sbjct: 779 SALSMPIPPVLATFQSCLSSPRNQLQDLLKTDSGNHLDMPTANLVCKMRRVNLDS 833 >XP_013443607.1 oligomeric component-related/COG complex component [Medicago truncatula] KEH17632.1 oligomeric component-related/COG complex component [Medicago truncatula] Length = 834 Score = 86.7 bits (213), Expect = 4e-17 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIP VLATF SCLS SRD+LKDLLKTD QLD+PTANLVCKMR++NLDS Sbjct: 780 SALSMPIPAVLATFHSCLSTSRDQLKDLLKTDSANQLDLPTANLVCKMRQLNLDS 834 >XP_003618191.1 oligomeric component-related/COG complex component [Medicago truncatula] AES74409.1 oligomeric component-related/COG complex component [Medicago truncatula] Length = 828 Score = 85.9 bits (211), Expect = 8e-17 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 3/55 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLDS 158 +ALSMPIP VL TF SCLS SRD+LKDLLKTD LD+PTANLVCKMRRVNLDS Sbjct: 774 SALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNLDS 828 >OMO98121.1 Conserved oligomeric Golgi complex subunit 7 [Corchorus olitorius] Length = 421 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/54 (77%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLD 155 +ALSMP PPVLATFQ+CL RD+LKDLLK+D QLD+PTANLVCKMRRVNLD Sbjct: 367 SALSMPTPPVLATFQTCLGTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRVNLD 420 >AIU51139.1 embryo yellow protein, partial [Artemisia annua] Length = 98 Score = 79.0 bits (193), Expect = 2e-16 Identities = 37/53 (69%), Positives = 46/53 (86%), Gaps = 2/53 (3%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD--QLDVPTANLVCKMRRVNLD 155 + LSMPIPP+LATF +CLS RD+LKD++KTD LD+PTANLVCKMRRV+L+ Sbjct: 46 SVLSMPIPPILATFHTCLSTPRDQLKDVIKTDSESLDLPTANLVCKMRRVSLE 98 >OMO94890.1 Oligomeric Golgi complex component [Corchorus capsularis] Length = 784 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/54 (77%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLD 155 +ALSMP PPVLATFQ+CL RD+LKDLLK+D QLD+PTANLVCKMRRVNLD Sbjct: 730 SALSMPTPPVLATFQTCLGTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRVNLD 783 >XP_016721195.1 PREDICTED: conserved oligomeric Golgi complex subunit 7-like [Gossypium hirsutum] Length = 830 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/54 (75%), Positives = 48/54 (88%), Gaps = 3/54 (5%) Frame = +3 Query: 3 AALSMPIPPVLATFQSCLSASRDELKDLLKTD---QLDVPTANLVCKMRRVNLD 155 +ALSMPIPPVLATFQ+CL RD+LKDLLK+D QLD+PTANLVCK+RR+NLD Sbjct: 777 SALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDIPTANLVCKIRRLNLD 830