BLASTX nr result
ID: Glycyrrhiza31_contig00012924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00012924 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013447280.1 Serine/Threonine kinase family protein [Medicago ... 56 1e-06 KHN16703.1 Serine/threonine-protein kinase [Glycine soja] 55 3e-06 XP_003530528.1 PREDICTED: serine/threonine-protein kinase At5g01... 55 4e-06 OIW09891.1 hypothetical protein TanjilG_32040 [Lupinus angustifo... 52 7e-06 >XP_013447280.1 Serine/Threonine kinase family protein [Medicago truncatula] KEH21307.1 Serine/Threonine kinase family protein [Medicago truncatula] Length = 386 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 382 KGETEEDQLLYSGGSSITIYEVPKGSNDTPT 290 K E EED++L SGGSS+TIYEVPKGSNDTPT Sbjct: 354 KEENEEDKILQSGGSSVTIYEVPKGSNDTPT 384 >KHN16703.1 Serine/threonine-protein kinase [Glycine soja] Length = 343 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 382 KGETEEDQLLYSGGSSITIYEVPKGSNDTPT 290 KG EEDQ+L +GG+S+T+YEVPKGSNDTPT Sbjct: 313 KGGNEEDQMLQTGGTSVTLYEVPKGSNDTPT 343 >XP_003530528.1 PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine max] KRH41391.1 hypothetical protein GLYMA_08G027100 [Glycine max] KRH41392.1 hypothetical protein GLYMA_08G027100 [Glycine max] Length = 379 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 382 KGETEEDQLLYSGGSSITIYEVPKGSNDTPT 290 KG EEDQ+L +GG+S+T+YEVPKGSNDTPT Sbjct: 349 KGGNEEDQMLQTGGTSVTLYEVPKGSNDTPT 379 >OIW09891.1 hypothetical protein TanjilG_32040 [Lupinus angustifolius] Length = 162 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 382 KGETEEDQLLYSGGSSITIYEVPKGSNDTPT*G 284 KGE EEDQLL SG SS+TIYEVPKG++DT T G Sbjct: 126 KGEFEEDQLLRSGSSSVTIYEVPKGTDDTTTEG 158