BLASTX nr result
ID: Glycyrrhiza31_contig00012597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00012597 (535 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442442.1 telomerase activating protein Est1 [Medicago trun... 63 2e-08 GAU32809.1 hypothetical protein TSUD_152580 [Trifolium subterran... 62 7e-08 >XP_013442442.1 telomerase activating protein Est1 [Medicago truncatula] KEH16467.1 telomerase activating protein Est1 [Medicago truncatula] Length = 1040 Score = 63.2 bits (152), Expect = 2e-08 Identities = 34/58 (58%), Positives = 39/58 (67%) Frame = -1 Query: 526 AASLLYRFKLQFSCLVIDCCWSLFGLDLLQELATPKEFAYKLLKILLSSQARMEEDKQ 353 AAS Y FKLQ LVI CCWS FGLDLLQ++AT K++A SQAR +EDKQ Sbjct: 980 AASFCYSFKLQLCGLVIGCCWSSFGLDLLQDVATTKDYAE-------VSQARTKEDKQ 1030 >GAU32809.1 hypothetical protein TSUD_152580 [Trifolium subterraneum] Length = 996 Score = 61.6 bits (148), Expect = 7e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 532 QCAASLLYRFKLQFSCLVIDCCWSLFGLDLLQELATPKEFA 410 +CAAS Y FKLQ LVI CCWS FGLDLLQ++AT K++A Sbjct: 947 KCAASFCYSFKLQLCSLVIGCCWSSFGLDLLQDIATTKDYA 987