BLASTX nr result
ID: Glycyrrhiza31_contig00012502
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00012502 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004504462.1 PREDICTED: U-box domain-containing protein 6-like... 68 1e-10 GAU30229.1 hypothetical protein TSUD_67810 [Trifolium subterraneum] 67 3e-10 XP_016191104.1 PREDICTED: U-box domain-containing protein 45-lik... 66 4e-10 XP_016191103.1 PREDICTED: U-box domain-containing protein 6-like... 66 4e-10 XP_013446540.1 plant U-box protein [Medicago truncatula] KEH2056... 65 8e-10 XP_015957990.1 PREDICTED: U-box domain-containing protein 45-lik... 65 2e-09 XP_015957989.1 PREDICTED: U-box domain-containing protein 6-like... 65 2e-09 XP_007158700.1 hypothetical protein PHAVU_002G175000g [Phaseolus... 62 1e-08 XP_014509804.1 PREDICTED: U-box domain-containing protein 6-like... 61 2e-08 KHN34809.1 U-box domain-containing protein 6 [Glycine soja] 61 2e-08 XP_003524886.1 PREDICTED: U-box domain-containing protein 45-lik... 61 2e-08 XP_017407509.1 PREDICTED: U-box domain-containing protein 6 [Vig... 61 3e-08 XP_003531187.1 PREDICTED: U-box domain-containing protein 6-like... 60 8e-08 KYP52956.1 U-box domain-containing protein 6 [Cajanus cajan] 59 1e-07 XP_008444446.1 PREDICTED: U-box domain-containing protein 45-lik... 59 2e-07 XP_016180828.1 PREDICTED: U-box domain-containing protein 6-like... 58 3e-07 XP_016188862.1 PREDICTED: U-box domain-containing protein 6-like... 58 3e-07 XP_019445800.1 PREDICTED: U-box domain-containing protein 45-lik... 57 7e-07 XP_004502310.1 PREDICTED: U-box domain-containing protein 45-lik... 57 7e-07 EEF47498.1 ubiquitin-protein ligase, putative [Ricinus communis] 57 7e-07 >XP_004504462.1 PREDICTED: U-box domain-containing protein 6-like [Cicer arietinum] XP_004504463.1 PREDICTED: U-box domain-containing protein 6-like [Cicer arietinum] Length = 765 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEMKPPCKSMSR KTGK S FWRSKSYSVYQC Sbjct: 730 MPPAEMKPPCKSMSRRKTGKGFSLFWRSKSYSVYQC 765 Score = 59.7 bits (143), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -3 Query: 102 HQSPPESSDLSVPPAEMKPPCKSMS-RKTGKALS 4 HQ PPE+SDLS+PPAEMKPPCKSMS RKTGK S Sbjct: 719 HQCPPETSDLSMPPAEMKPPCKSMSRRKTGKGFS 752 >GAU30229.1 hypothetical protein TSUD_67810 [Trifolium subterraneum] Length = 766 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 VPPAEMKP CKS++R KTGKA SFFWRSKSYSVYQC Sbjct: 731 VPPAEMKPLCKSLTRRKTGKAFSFFWRSKSYSVYQC 766 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -3 Query: 102 HQSPPESSDLSVPPAEMKPPCKSMS-RKTGKALSF 1 HQSPPE+SD SVPPAEMKP CKS++ RKTGKA SF Sbjct: 720 HQSPPETSDFSVPPAEMKPLCKSLTRRKTGKAFSF 754 >XP_016191104.1 PREDICTED: U-box domain-containing protein 45-like isoform X2 [Arachis ipaensis] Length = 745 Score = 66.2 bits (160), Expect = 4e-10 Identities = 30/36 (83%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PP+EMKP CKSMSR KTGKA SFFW+SKSYSVYQC Sbjct: 710 MPPSEMKPQCKSMSRSKTGKAFSFFWKSKSYSVYQC 745 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -3 Query: 105 AHQSPPESSDLSVPPAEMKPPCKSMSR-KTGKALSF 1 AH PPE+SDLS+PP+EMKP CKSMSR KTGKA SF Sbjct: 698 AHHCPPETSDLSMPPSEMKPQCKSMSRSKTGKAFSF 733 >XP_016191103.1 PREDICTED: U-box domain-containing protein 6-like isoform X1 [Arachis ipaensis] Length = 766 Score = 66.2 bits (160), Expect = 4e-10 Identities = 30/36 (83%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PP+EMKP CKSMSR KTGKA SFFW+SKSYSVYQC Sbjct: 731 MPPSEMKPQCKSMSRSKTGKAFSFFWKSKSYSVYQC 766 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -3 Query: 105 AHQSPPESSDLSVPPAEMKPPCKSMSR-KTGKALSF 1 AH PPE+SDLS+PP+EMKP CKSMSR KTGKA SF Sbjct: 719 AHHCPPETSDLSMPPSEMKPQCKSMSRSKTGKAFSF 754 >XP_013446540.1 plant U-box protein [Medicago truncatula] KEH20567.1 plant U-box protein [Medicago truncatula] Length = 767 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 VPPAEMKP CKS+SR KTGK SFFWRSKSYSVYQC Sbjct: 732 VPPAEMKPLCKSISRRKTGKPFSFFWRSKSYSVYQC 767 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -3 Query: 102 HQSPPESSDLSVPPAEMKPPCKSMS-RKTGKALSF 1 HQ PPE+SDLSVPPAEMKP CKS+S RKTGK SF Sbjct: 721 HQCPPETSDLSVPPAEMKPLCKSISRRKTGKPFSF 755 >XP_015957990.1 PREDICTED: U-box domain-containing protein 45-like isoform X2 [Arachis duranensis] Length = 745 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PP+EMKP CKSMSR KTGKA SFFW+SKS+SVYQC Sbjct: 710 MPPSEMKPQCKSMSRSKTGKAFSFFWKSKSFSVYQC 745 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -3 Query: 105 AHQSPPESSDLSVPPAEMKPPCKSMSR-KTGKALSF 1 AH PPE++DLS+PP+EMKP CKSMSR KTGKA SF Sbjct: 698 AHHCPPETNDLSMPPSEMKPQCKSMSRSKTGKAFSF 733 >XP_015957989.1 PREDICTED: U-box domain-containing protein 6-like isoform X1 [Arachis duranensis] Length = 766 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PP+EMKP CKSMSR KTGKA SFFW+SKS+SVYQC Sbjct: 731 MPPSEMKPQCKSMSRSKTGKAFSFFWKSKSFSVYQC 766 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -3 Query: 105 AHQSPPESSDLSVPPAEMKPPCKSMSR-KTGKALSF 1 AH PPE++DLS+PP+EMKP CKSMSR KTGKA SF Sbjct: 719 AHHCPPETNDLSMPPSEMKPQCKSMSRSKTGKAFSF 754 >XP_007158700.1 hypothetical protein PHAVU_002G175000g [Phaseolus vulgaris] ESW30694.1 hypothetical protein PHAVU_002G175000g [Phaseolus vulgaris] Length = 763 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEMKP CKS+SR K+G+A SFFW+SKSYSVYQC Sbjct: 728 MPPAEMKPLCKSISRRKSGRAFSFFWKSKSYSVYQC 763 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -3 Query: 102 HQSPPESSDLSVPPAEMKPPCKSMS-RKTGKALSF 1 HQ PPE+SDLS+PPAEMKP CKS+S RK+G+A SF Sbjct: 717 HQCPPETSDLSMPPAEMKPLCKSISRRKSGRAFSF 751 >XP_014509804.1 PREDICTED: U-box domain-containing protein 6-like [Vigna radiata var. radiata] XP_014509805.1 PREDICTED: U-box domain-containing protein 6-like [Vigna radiata var. radiata] Length = 763 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEMKP CKS+SR K+G+A SFFW+SK+YSVYQC Sbjct: 728 MPPAEMKPLCKSISRRKSGRAFSFFWKSKTYSVYQC 763 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/35 (71%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -3 Query: 102 HQSPPESSDLSVPPAEMKPPCKSMS-RKTGKALSF 1 HQ PPE++DLS+PPAEMKP CKS+S RK+G+A SF Sbjct: 717 HQCPPETADLSMPPAEMKPLCKSISRRKSGRAFSF 751 >KHN34809.1 U-box domain-containing protein 6 [Glycine soja] Length = 764 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEMKP CKS+SR K+G+A SFFW++KSYSVYQC Sbjct: 729 MPPAEMKPLCKSISRRKSGRAFSFFWKNKSYSVYQC 764 >XP_003524886.1 PREDICTED: U-box domain-containing protein 45-like [Glycine max] XP_006580117.1 PREDICTED: U-box domain-containing protein 45-like [Glycine max] KRH58754.1 hypothetical protein GLYMA_05G146300 [Glycine max] KRH58755.1 hypothetical protein GLYMA_05G146300 [Glycine max] Length = 764 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEMKP CKS+SR K+G+A SFFW++KSYSVYQC Sbjct: 729 MPPAEMKPLCKSISRRKSGRAFSFFWKNKSYSVYQC 764 >XP_017407509.1 PREDICTED: U-box domain-containing protein 6 [Vigna angularis] XP_017407516.1 PREDICTED: U-box domain-containing protein 6 [Vigna angularis] KOM31398.1 hypothetical protein LR48_Vigan01g095300 [Vigna angularis] BAT74346.1 hypothetical protein VIGAN_01199700 [Vigna angularis var. angularis] Length = 763 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEMKP CKS+SR K+G+ SFFW+SKSYSVYQC Sbjct: 728 MPPAEMKPLCKSISRRKSGRTFSFFWKSKSYSVYQC 763 >XP_003531187.1 PREDICTED: U-box domain-containing protein 6-like [Glycine max] KHN12401.1 U-box domain-containing protein 6 [Glycine soja] KRH42648.1 hypothetical protein GLYMA_08G103100 [Glycine max] KRH42649.1 hypothetical protein GLYMA_08G103100 [Glycine max] Length = 766 Score = 59.7 bits (143), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKS-MSRKTGKALSFFWRSKSYSVYQC 206 +PPAEMKP CKS + RK+G+A SFFW++KSYSVYQC Sbjct: 731 MPPAEMKPICKSILRRKSGRAFSFFWKNKSYSVYQC 766 >KYP52956.1 U-box domain-containing protein 6 [Cajanus cajan] Length = 778 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/36 (72%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +PPAEM+P CKS+SR K+GK +FFW+SKSYSVYQC Sbjct: 743 MPPAEMQPLCKSISRRKSGKTFNFFWKSKSYSVYQC 778 >XP_008444446.1 PREDICTED: U-box domain-containing protein 45-like [Cucumis melo] XP_008444447.1 PREDICTED: U-box domain-containing protein 45-like [Cucumis melo] Length = 780 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +3 Query: 93 GSDVPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 G+ V AE KP CKS+SR KTGKALSF W+SKSYSVYQC Sbjct: 742 GTSVGMAESKPLCKSISRRKTGKALSFLWKSKSYSVYQC 780 >XP_016180828.1 PREDICTED: U-box domain-containing protein 6-like [Arachis ipaensis] Length = 751 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 96 SDVPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 S +P EMKP CKS SR K GKALSF W+SKSYSVYQC Sbjct: 714 SSMPKPEMKPLCKSTSRRKVGKALSFLWKSKSYSVYQC 751 >XP_016188862.1 PREDICTED: U-box domain-containing protein 6-like [Arachis ipaensis] Length = 757 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +3 Query: 96 SDVPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 S +P EMKP CKS SR K GKALSF W+SKSYSVYQC Sbjct: 720 SSMPKPEMKPLCKSTSRRKVGKALSFLWKSKSYSVYQC 757 >XP_019445800.1 PREDICTED: U-box domain-containing protein 45-like [Lupinus angustifolius] XP_019445808.1 PREDICTED: U-box domain-containing protein 45-like [Lupinus angustifolius] XP_019445816.1 PREDICTED: U-box domain-containing protein 45-like [Lupinus angustifolius] OIW19146.1 hypothetical protein TanjilG_18301 [Lupinus angustifolius] Length = 764 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSRKT-GKALSFFWRSKSYSVYQC 206 +PPAE KP CKSMSRK GKA SFFW++KSYS+ QC Sbjct: 729 MPPAEAKPQCKSMSRKKPGKAFSFFWKTKSYSLSQC 764 >XP_004502310.1 PREDICTED: U-box domain-containing protein 45-like [Cicer arietinum] XP_004502311.1 PREDICTED: U-box domain-containing protein 45-like [Cicer arietinum] Length = 766 Score = 57.0 bits (136), Expect = 7e-07 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSRK-TGKALSFFWRSKSYSVYQC 206 +PP E KP CKS+SR+ GKALSF W+SKSYSVYQC Sbjct: 731 MPPQETKPLCKSISRRRVGKALSFLWKSKSYSVYQC 766 >EEF47498.1 ubiquitin-protein ligase, putative [Ricinus communis] Length = 774 Score = 57.0 bits (136), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = +3 Query: 102 VPPAEMKPPCKSMSR-KTGKALSFFWRSKSYSVYQC 206 +P E KP CKS+SR K GKALSFFW+SKSYSVYQC Sbjct: 739 MPAQESKPLCKSVSRRKMGKALSFFWKSKSYSVYQC 774