BLASTX nr result
ID: Glycyrrhiza31_contig00012052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00012052 (392 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH31409.1 hypothetical protein GLYMA_11G246500 [Glycine max] 54 6e-06 XP_006591474.1 PREDICTED: uncharacterized protein LOC102668424 [... 54 6e-06 XP_007163716.1 hypothetical protein PHAVU_001G258100g [Phaseolus... 54 6e-06 XP_003552792.2 PREDICTED: uncharacterized protein LOC100799349 i... 54 6e-06 XP_006601908.1 PREDICTED: uncharacterized protein LOC100799349 i... 54 6e-06 >KRH31409.1 hypothetical protein GLYMA_11G246500 [Glycine max] Length = 613 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 291 FRSEERAIKC*ELLQRMDETKSKEEEKVQLQRS 389 FRSEERA+K E LQRMDETKSKEEEKV+LQR+ Sbjct: 472 FRSEERAVKRKEFLQRMDETKSKEEEKVKLQRT 504 >XP_006591474.1 PREDICTED: uncharacterized protein LOC102668424 [Glycine max] KRH31410.1 hypothetical protein GLYMA_11G246500 [Glycine max] Length = 618 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 291 FRSEERAIKC*ELLQRMDETKSKEEEKVQLQRS 389 FRSEERA+K E LQRMDETKSKEEEKV+LQR+ Sbjct: 477 FRSEERAVKRKEFLQRMDETKSKEEEKVKLQRT 509 >XP_007163716.1 hypothetical protein PHAVU_001G258100g [Phaseolus vulgaris] ESW35710.1 hypothetical protein PHAVU_001G258100g [Phaseolus vulgaris] Length = 641 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 291 FRSEERAIKC*ELLQRMDETKSKEEEKVQLQRS 389 FRSEERA+K E LQRMDETKSKEEEKV+LQR+ Sbjct: 498 FRSEERAVKRREFLQRMDETKSKEEEKVKLQRT 530 >XP_003552792.2 PREDICTED: uncharacterized protein LOC100799349 isoform X2 [Glycine max] KRG97480.1 hypothetical protein GLYMA_18G010600 [Glycine max] Length = 644 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 291 FRSEERAIKC*ELLQRMDETKSKEEEKVQLQRS 389 FRSEERA+K E LQRMDETKSKEEEKV+LQR+ Sbjct: 503 FRSEERAVKRKEFLQRMDETKSKEEEKVKLQRT 535 >XP_006601908.1 PREDICTED: uncharacterized protein LOC100799349 isoform X1 [Glycine max] KRG97481.1 hypothetical protein GLYMA_18G010600 [Glycine max] Length = 654 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 291 FRSEERAIKC*ELLQRMDETKSKEEEKVQLQRS 389 FRSEERA+K E LQRMDETKSKEEEKV+LQR+ Sbjct: 513 FRSEERAVKRKEFLQRMDETKSKEEEKVKLQRT 545