BLASTX nr result
ID: Glycyrrhiza31_contig00011740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00011740 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHM99291.1 Cystinosin like [Glycine soja] 85 2e-18 KRG94383.1 hypothetical protein GLYMA_19G080800 [Glycine max] 85 5e-18 XP_003553892.1 PREDICTED: cystinosin homolog [Glycine max] KRG94... 85 1e-17 XP_019458854.1 PREDICTED: cystinosin homolog [Lupinus angustifol... 83 4e-17 XP_017417662.1 PREDICTED: cystinosin homolog isoform X1 [Vigna a... 79 2e-15 KYP50223.1 Cystinosin isogeny [Cajanus cajan] 76 2e-15 XP_004488939.1 PREDICTED: cystinosin homolog [Cicer arietinum] 77 6e-15 XP_007140838.1 hypothetical protein PHAVU_008G145800g [Phaseolus... 76 2e-14 XP_014491202.1 PREDICTED: cystinosin homolog isoform X1 [Vigna r... 75 6e-14 XP_015938367.1 PREDICTED: cystinosin homolog [Arachis duranensis... 74 1e-13 AFK47052.1 unknown [Lotus japonicus] 71 1e-12 AFK45532.1 unknown [Lotus japonicus] 71 1e-12 XP_013443380.1 lysosomal cystine transporter family protein [Med... 70 2e-12 EEF35426.1 cystinosin, putative [Ricinus communis] 62 3e-09 XP_015579519.1 PREDICTED: cystinosin homolog isoform X2 [Ricinus... 62 3e-09 XP_015579518.1 PREDICTED: cystinosin homolog isoform X1 [Ricinus... 62 3e-09 XP_019451157.1 PREDICTED: cystinosin homolog [Lupinus angustifol... 61 8e-09 OAY29569.1 hypothetical protein MANES_15G155300 [Manihot esculenta] 60 2e-08 XP_015579501.1 PREDICTED: cystinosin homolog [Ricinus communis] 59 4e-08 XP_010660827.1 PREDICTED: cystinosin homolog isoform X1 [Vitis v... 59 4e-08 >KHM99291.1 Cystinosin like [Glycine soja] Length = 186 Score = 84.7 bits (208), Expect = 2e-18 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVS+FFDILFMCQHYLLYP +KRK E +PEPD+AK SD P+SEN Sbjct: 137 KLLLSLVSLFFDILFMCQHYLLYPEKKRKLEGSPEPDNAKSSDRPLSEN 185 >KRG94383.1 hypothetical protein GLYMA_19G080800 [Glycine max] Length = 221 Score = 84.7 bits (208), Expect = 5e-18 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVS+FFDILFMCQHYLLYP +KRK E +PEPD+AK SD P+SEN Sbjct: 172 KLLLSLVSLFFDILFMCQHYLLYPEKKRKLEGSPEPDNAKSSDRPLSEN 220 >XP_003553892.1 PREDICTED: cystinosin homolog [Glycine max] KRG94382.1 hypothetical protein GLYMA_19G080800 [Glycine max] Length = 270 Score = 84.7 bits (208), Expect = 1e-17 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVS+FFDILFMCQHYLLYP +KRK E +PEPD+AK SD P+SEN Sbjct: 221 KLLLSLVSLFFDILFMCQHYLLYPEKKRKLEGSPEPDNAKSSDRPLSEN 269 >XP_019458854.1 PREDICTED: cystinosin homolog [Lupinus angustifolius] OIW03003.1 hypothetical protein TanjilG_13640 [Lupinus angustifolius] Length = 270 Score = 83.2 bits (204), Expect = 4e-17 Identities = 39/49 (79%), Positives = 42/49 (85%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVSVFFDILFMCQHYLLYP +KRKSE +P PD+AKP D SEN Sbjct: 221 KLLLSLVSVFFDILFMCQHYLLYPTKKRKSETSPRPDNAKPLDRSSSEN 269 >XP_017417662.1 PREDICTED: cystinosin homolog isoform X1 [Vigna angularis] KOM38453.1 hypothetical protein LR48_Vigan03g183500 [Vigna angularis] BAT84837.1 hypothetical protein VIGAN_04230000 [Vigna angularis var. angularis] Length = 269 Score = 79.0 bits (193), Expect = 2e-15 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGP 181 KLLLSLVSVFFDILFMCQHYLLYP +KRK EA+PE DSAK SD P Sbjct: 221 KLLLSLVSVFFDILFMCQHYLLYPVKKRKLEASPERDSAKSSDKP 265 >KYP50223.1 Cystinosin isogeny [Cajanus cajan] Length = 128 Score = 75.9 bits (185), Expect = 2e-15 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 297 VSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 VSVFFDILFMCQHYLLYP +KRK EA+PEPD+AK D P+SEN Sbjct: 85 VSVFFDILFMCQHYLLYPVKKRKLEASPEPDNAKSLDRPLSEN 127 >XP_004488939.1 PREDICTED: cystinosin homolog [Cicer arietinum] Length = 267 Score = 77.4 bits (189), Expect = 6e-15 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVSVFFDILFMCQHY+LYP +KRKSEA+PE AK SD P+SEN Sbjct: 221 KLLLSLVSVFFDILFMCQHYVLYPEKKRKSEASPE---AKTSDYPLSEN 266 >XP_007140838.1 hypothetical protein PHAVU_008G145800g [Phaseolus vulgaris] ESW12832.1 hypothetical protein PHAVU_008G145800g [Phaseolus vulgaris] Length = 269 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGP 181 KL+LSLVSVFFDI+FMCQHYLLYP +KRK EA+PE D+AK SD P Sbjct: 221 KLMLSLVSVFFDIIFMCQHYLLYPVKKRKLEASPEHDNAKSSDRP 265 >XP_014491202.1 PREDICTED: cystinosin homolog isoform X1 [Vigna radiata var. radiata] Length = 269 Score = 74.7 bits (182), Expect = 6e-14 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGP 181 KLLLSLVSVFFDI+FMCQHYLLYP + RK EA+PE D+AK SD P Sbjct: 221 KLLLSLVSVFFDIIFMCQHYLLYPVKTRKLEASPEHDNAKSSDRP 265 >XP_015938367.1 PREDICTED: cystinosin homolog [Arachis duranensis] XP_016177249.1 PREDICTED: cystinosin homolog [Arachis ipaensis] Length = 270 Score = 73.9 bits (180), Expect = 1e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVSVFFDILF+CQHYLLYP+++R+SE E D+ KPSD SEN Sbjct: 221 KLLLSLVSVFFDILFICQHYLLYPSKRRRSETNIEHDNVKPSDRQSSEN 269 >AFK47052.1 unknown [Lotus japonicus] Length = 271 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLL+SLVSVFFDILFM QHYLLYPA KRKSE +P+ D+ K S+ +S+N Sbjct: 222 KLLISLVSVFFDILFMIQHYLLYPASKRKSETSPDLDNPKSSNRQLSDN 270 >AFK45532.1 unknown [Lotus japonicus] Length = 271 Score = 71.2 bits (173), Expect = 1e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLL+SLVSVFFDILFM QHYLLYPA KRKSE +P+ D+ K S+ +S+N Sbjct: 222 KLLISLVSVFFDILFMIQHYLLYPASKRKSETSPDLDNPKSSNRQLSDN 270 >XP_013443380.1 lysosomal cystine transporter family protein [Medicago truncatula] KEH17405.1 lysosomal cystine transporter family protein [Medicago truncatula] Length = 270 Score = 70.5 bits (171), Expect = 2e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVS+FFDILF+ QHY+LYP RKRK E +P+ D+AK SD ++EN Sbjct: 221 KLLLSLVSIFFDILFIIQHYVLYPERKRKLETSPDFDNAKSSDQTLAEN 269 >EEF35426.1 cystinosin, putative [Ricinus communis] Length = 244 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSE 172 K LLSLVS+FFD+LFM QHY+LYPA+K+K A+PE + ++ P S+ Sbjct: 193 KTLLSLVSIFFDLLFMFQHYILYPAKKKKENASPETERDSAAEPPSSQ 240 >XP_015579519.1 PREDICTED: cystinosin homolog isoform X2 [Ricinus communis] Length = 273 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSE 172 K LLSLVS+FFD+LFM QHY+LYPA+K+K A+PE + ++ P S+ Sbjct: 222 KTLLSLVSIFFDLLFMFQHYILYPAKKKKENASPETERDSAAEPPSSQ 269 >XP_015579518.1 PREDICTED: cystinosin homolog isoform X1 [Ricinus communis] Length = 282 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSE 172 K LLSLVS+FFD+LFM QHY+LYPA+K+K A+PE + ++ P S+ Sbjct: 231 KTLLSLVSIFFDLLFMFQHYILYPAKKKKENASPETERDSAAEPPSSQ 278 >XP_019451157.1 PREDICTED: cystinosin homolog [Lupinus angustifolius] Length = 270 Score = 60.8 bits (146), Expect = 8e-09 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKPSDGPMSEN 169 K+L+SLVSV FDI+F+CQHYLLYPA S+ E ++ K D P++EN Sbjct: 221 KVLVSLVSVLFDIIFICQHYLLYPANNTTSQTTTEHNNCKSLDQPLAEN 269 >OAY29569.1 hypothetical protein MANES_15G155300 [Manihot esculenta] Length = 274 Score = 60.1 bits (144), Expect = 2e-08 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKP----SDGPMSEN 169 K LLSLVSVFFD+LFMCQH++LYPA+K P A+P +D P SEN Sbjct: 221 KTLLSLVSVFFDLLFMCQHFILYPAKKAHISLKPNKAGAEPLIKSADDPPSEN 273 >XP_015579501.1 PREDICTED: cystinosin homolog [Ricinus communis] Length = 274 Score = 58.9 bits (141), Expect = 4e-08 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARKRKSEAAPEPDSAKP----SDGPMSEN 169 K LLSLVSVFFD+LFMCQHY+LYP RK + + + A+P SD SEN Sbjct: 221 KTLLSLVSVFFDLLFMCQHYILYPERKAHASSKISKEGAEPFIKSSDDSSSEN 273 >XP_010660827.1 PREDICTED: cystinosin homolog isoform X1 [Vitis vinifera] Length = 274 Score = 58.9 bits (141), Expect = 4e-08 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 5/54 (9%) Frame = -2 Query: 315 KLLLSLVSVFFDILFMCQHYLLYPARK-----RKSEAAPEPDSAKPSDGPMSEN 169 KLLLSLVSVFFD++F+CQHYLLYP +K + E + EP K SD P SEN Sbjct: 221 KLLLSLVSVFFDLIFICQHYLLYPGKKAGKCPKLGEESTEP-LIKSSDHPESEN 273