BLASTX nr result
ID: Glycyrrhiza31_contig00010904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00010904 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008238099.1 PREDICTED: cyclin-dependent kinase F-4 [Prunus mume] 75 6e-13 XP_007209990.1 hypothetical protein PRUPE_ppa005252mg [Prunus pe... 75 6e-13 XP_009365744.1 PREDICTED: cyclin-dependent kinase F-4 [Pyrus x b... 75 6e-13 XP_008373453.1 PREDICTED: cyclin-dependent kinase F-4 [Malus dom... 75 6e-13 XP_011465051.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2... 73 3e-12 XP_011465050.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1... 73 3e-12 XP_016201219.1 PREDICTED: cyclin-dependent kinase F-4-like [Arac... 66 5e-11 XP_007156359.1 hypothetical protein PHAVU_003G279600g [Phaseolus... 67 3e-10 XP_003547727.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2... 67 3e-10 XP_006599209.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2... 67 3e-10 XP_011028055.1 PREDICTED: cyclin-dependent kinase F-4 [Populus e... 67 3e-10 OAY29976.1 hypothetical protein MANES_15G186800 [Manihot esculenta] 67 3e-10 XP_014509245.1 PREDICTED: cyclin-dependent kinase F-4-like isofo... 67 3e-10 XP_017405605.1 PREDICTED: cyclin-dependent kinase F-4-like [Vign... 67 3e-10 XP_002519870.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2... 67 3e-10 XP_014624400.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1... 67 3e-10 XP_014624429.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1... 67 3e-10 XP_012075067.1 PREDICTED: cyclin-dependent kinase F-4 [Jatropha ... 67 3e-10 XP_014509240.1 PREDICTED: cyclin-dependent kinase F-4-like isofo... 67 3e-10 GAU51273.1 hypothetical protein TSUD_187690 [Trifolium subterran... 67 3e-10 >XP_008238099.1 PREDICTED: cyclin-dependent kinase F-4 [Prunus mume] Length = 470 Score = 75.1 bits (183), Expect = 6e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 125 RAALGSVGTMERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 RAAL S G MERYKLIKEVGDGTFGSVWRAINKQ+GEVVAI Sbjct: 8 RAALCSTGRMERYKLIKEVGDGTFGSVWRAINKQTGEVVAI 48 >XP_007209990.1 hypothetical protein PRUPE_ppa005252mg [Prunus persica] ONI05723.1 hypothetical protein PRUPE_5G021300 [Prunus persica] Length = 470 Score = 75.1 bits (183), Expect = 6e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 125 RAALGSVGTMERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 RAAL S G MERYKLIKEVGDGTFGSVWRAINKQ+GEVVAI Sbjct: 8 RAALCSTGRMERYKLIKEVGDGTFGSVWRAINKQTGEVVAI 48 >XP_009365744.1 PREDICTED: cyclin-dependent kinase F-4 [Pyrus x bretschneideri] XP_018505035.1 PREDICTED: cyclin-dependent kinase F-4 [Pyrus x bretschneideri] Length = 472 Score = 75.1 bits (183), Expect = 6e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 125 RAALGSVGTMERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 RAAL S G MERYKLIKEVGDGTFGSVWRAINKQ+GEVVAI Sbjct: 8 RAALCSTGRMERYKLIKEVGDGTFGSVWRAINKQTGEVVAI 48 >XP_008373453.1 PREDICTED: cyclin-dependent kinase F-4 [Malus domestica] XP_008364481.1 PREDICTED: cyclin-dependent kinase F-4-like [Malus domestica] Length = 476 Score = 75.1 bits (183), Expect = 6e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 125 RAALGSVGTMERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 RAAL S G MERYKLIKEVGDGTFGSVWRAINKQ+GEVVAI Sbjct: 8 RAALCSTGRMERYKLIKEVGDGTFGSVWRAINKQTGEVVAI 48 >XP_011465051.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Fragaria vesca subsp. vesca] Length = 469 Score = 73.2 bits (178), Expect = 3e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 125 RAALGSVGTMERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 RAAL S G MERYKLIKEVGDGTFG+VWRAINKQ+GEVVAI Sbjct: 8 RAALCSSGRMERYKLIKEVGDGTFGTVWRAINKQTGEVVAI 48 >XP_011465050.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Fragaria vesca subsp. vesca] Length = 470 Score = 73.2 bits (178), Expect = 3e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -2 Query: 125 RAALGSVGTMERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 RAAL S G MERYKLIKEVGDGTFG+VWRAINKQ+GEVVAI Sbjct: 8 RAALCSSGRMERYKLIKEVGDGTFGTVWRAINKQTGEVVAI 48 >XP_016201219.1 PREDICTED: cyclin-dependent kinase F-4-like [Arachis ipaensis] Length = 138 Score = 66.2 bits (160), Expect = 5e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQ+GEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQTGEVVAI 32 >XP_007156359.1 hypothetical protein PHAVU_003G279600g [Phaseolus vulgaris] ESW28353.1 hypothetical protein PHAVU_003G279600g [Phaseolus vulgaris] Length = 448 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_003547727.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Glycine max] KHN27523.1 Cyclin-dependent kinase F-4 [Glycine soja] Length = 450 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_006599209.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Glycine max] KRH07697.1 hypothetical protein GLYMA_16G104600 [Glycine max] Length = 451 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_011028055.1 PREDICTED: cyclin-dependent kinase F-4 [Populus euphratica] Length = 452 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >OAY29976.1 hypothetical protein MANES_15G186800 [Manihot esculenta] Length = 453 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_014509245.1 PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Vigna radiata var. radiata] Length = 453 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_017405605.1 PREDICTED: cyclin-dependent kinase F-4-like [Vigna angularis] XP_017405611.1 PREDICTED: cyclin-dependent kinase F-4-like [Vigna angularis] XP_017405617.1 PREDICTED: cyclin-dependent kinase F-4-like [Vigna angularis] XP_017405624.1 PREDICTED: cyclin-dependent kinase F-4-like [Vigna angularis] XP_017405631.1 PREDICTED: cyclin-dependent kinase F-4-like [Vigna angularis] KOM32023.1 hypothetical protein LR48_Vigan01g157900 [Vigna angularis] BAT75193.1 hypothetical protein VIGAN_01301700 [Vigna angularis var. angularis] Length = 453 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_002519870.1 PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Ricinus communis] EEF42474.1 mak, putative [Ricinus communis] Length = 455 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_014624400.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Glycine max] XP_014624401.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Glycine max] XP_014624402.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Glycine max] Length = 456 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_014624429.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Glycine max] XP_014624430.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Glycine max] XP_014624431.1 PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Glycine max] Length = 457 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_012075067.1 PREDICTED: cyclin-dependent kinase F-4 [Jatropha curcas] KDP35422.1 hypothetical protein JCGZ_10805 [Jatropha curcas] Length = 459 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >XP_014509240.1 PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Vigna radiata var. radiata] XP_014509241.1 PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Vigna radiata var. radiata] XP_014509242.1 PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Vigna radiata var. radiata] XP_014509243.1 PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Vigna radiata var. radiata] XP_014509244.1 PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Vigna radiata var. radiata] Length = 476 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32 >GAU51273.1 hypothetical protein TSUD_187690 [Trifolium subterraneum] Length = 481 Score = 67.4 bits (163), Expect = 3e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 98 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 3 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAI 32