BLASTX nr result
ID: Glycyrrhiza31_contig00010877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00010877 (555 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN42604.1 Transcription factor bHLH25 [Glycine soja] 63 2e-08 XP_006573687.1 PREDICTED: transcription factor bHLH18-like isofo... 63 2e-08 XP_006573686.1 PREDICTED: transcription factor bHLH18-like isofo... 63 2e-08 ACN21641.1 putative basic helix-loop-helix protein BHLH17 [Lotus... 62 3e-08 XP_003611493.1 basic helix loop helix (bHLH) DNA-binding family ... 62 4e-08 GAU24840.1 hypothetical protein TSUD_157530 [Trifolium subterran... 61 5e-08 XP_007156672.1 hypothetical protein PHAVU_002G007400g [Phaseolus... 62 5e-08 KRH58190.1 hypothetical protein GLYMA_05G110900 [Glycine max] 61 8e-08 KHM99702.1 Transcription factor bHLH25 [Glycine soja] 61 8e-08 XP_006579969.1 PREDICTED: transcription factor bHLH18-like [Glyc... 61 8e-08 GAU50841.1 hypothetical protein TSUD_232180 [Trifolium subterran... 59 9e-08 XP_004511793.1 PREDICTED: transcription factor bHLH18-like [Cice... 61 1e-07 XP_013456276.1 basic helix loop helix (bHLH) DNA-binding family ... 60 1e-07 ACU24264.1 unknown [Glycine max] 59 2e-07 XP_014619312.1 PREDICTED: transcription factor bHLH25-like isofo... 60 2e-07 KYP53168.1 Transcription factor bHLH25 [Cajanus cajan] 60 2e-07 XP_003539216.1 PREDICTED: transcription factor bHLH25-like isofo... 60 2e-07 KHN01700.1 Transcription factor bHLH25 [Glycine soja] 59 4e-07 XP_003549987.1 PREDICTED: transcription factor bHLH18-like [Glyc... 59 4e-07 XP_013456258.1 basic helix loop helix (bHLH) DNA-binding family ... 59 5e-07 >KHN42604.1 Transcription factor bHLH25 [Glycine soja] Length = 365 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+ I+ +IQNLHLFV+NSS LPF DS+LDIT++AQ+ Sbjct: 296 RIHCQKQKGLLLNILVEIQNLHLFVVNSSVLPFGDSVLDITIVAQM 341 >XP_006573687.1 PREDICTED: transcription factor bHLH18-like isoform X2 [Glycine max] KRH77194.1 hypothetical protein GLYMA_01G198100 [Glycine max] Length = 365 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+ I+ +IQNLHLFV+NSS LPF DS+LDIT++AQ+ Sbjct: 296 RIHCQKQKGLLLNILVEIQNLHLFVVNSSVLPFGDSVLDITIVAQM 341 >XP_006573686.1 PREDICTED: transcription factor bHLH18-like isoform X1 [Glycine max] KRH77195.1 hypothetical protein GLYMA_01G198100 [Glycine max] Length = 368 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+ I+ +IQNLHLFV+NSS LPF DS+LDIT++AQ+ Sbjct: 299 RIHCQKQKGLLLNILVEIQNLHLFVVNSSVLPFGDSVLDITIVAQM 344 >ACN21641.1 putative basic helix-loop-helix protein BHLH17 [Lotus japonicus] Length = 382 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 ++ + KGLL+KI+ +IQNLHLFV+NSS LPF DSILDIT++AQ+ Sbjct: 312 RLHCKKQKGLLLKILFEIQNLHLFVVNSSVLPFGDSILDITIVAQM 357 >XP_003611493.1 basic helix loop helix (bHLH) DNA-binding family protein [Medicago truncatula] AES94451.1 basic helix loop helix (bHLH) DNA-binding family protein [Medicago truncatula] Length = 333 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+KI+ +IQ LHLFV+N+S LPF DSILDIT++AQ+ Sbjct: 264 RIHCQKQKGLLLKILVEIQKLHLFVVNNSVLPFGDSILDITIVAQM 309 >GAU24840.1 hypothetical protein TSUD_157530 [Trifolium subterraneum] Length = 262 Score = 61.2 bits (147), Expect = 5e-08 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQ 364 +I Q HKGL+VKI+A+IQ LFV+NSS LPF +SILDIT+IAQ Sbjct: 217 RIHCQKHKGLIVKIMAEIQRFQLFVVNSSVLPFGNSILDITIIAQ 261 >XP_007156672.1 hypothetical protein PHAVU_002G007400g [Phaseolus vulgaris] ESW28666.1 hypothetical protein PHAVU_002G007400g [Phaseolus vulgaris] Length = 336 Score = 61.6 bits (148), Expect = 5e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+KI+ +IQNLHLFV+NSS L F DSI+DIT++AQ+ Sbjct: 267 RIHCQKQKGLLLKILVEIQNLHLFVVNSSVLSFGDSIIDITIVAQM 312 >KRH58190.1 hypothetical protein GLYMA_05G110900 [Glycine max] Length = 361 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLLVK++A+IQ+ HLFV NSS LPF DSILDIT++AQ+ Sbjct: 292 RIHCQKQKGLLVKLLAEIQSHHLFVANSSVLPFGDSILDITIVAQM 337 >KHM99702.1 Transcription factor bHLH25 [Glycine soja] Length = 382 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLLVK++A+IQ+ HLFV NSS LPF DSILDIT++AQ+ Sbjct: 313 RIHCQKQKGLLVKLLAEIQSHHLFVANSSVLPFGDSILDITIVAQM 358 >XP_006579969.1 PREDICTED: transcription factor bHLH18-like [Glycine max] ALA09130.1 bHLH transcription factor, partial [Glycine max] KRH58189.1 hypothetical protein GLYMA_05G110900 [Glycine max] Length = 382 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLLVK++A+IQ+ HLFV NSS LPF DSILDIT++AQ+ Sbjct: 313 RIHCQKQKGLLVKLLAEIQSHHLFVANSSVLPFGDSILDITIVAQM 358 >GAU50841.1 hypothetical protein TSUD_232180 [Trifolium subterraneum] Length = 154 Score = 58.9 bits (141), Expect = 9e-08 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I + KGLL+K++ +IQ LHLFV+NSS LPF +SILDIT+IAQ+ Sbjct: 85 RIHCKKEKGLLLKVLFEIQKLHLFVVNSSVLPFGNSILDITIIAQM 130 >XP_004511793.1 PREDICTED: transcription factor bHLH18-like [Cicer arietinum] Length = 327 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQ 364 +I GLL+KI+ +IQNLHLFV+NSS LPF DSILDIT++AQ Sbjct: 258 RIHCHKQMGLLLKILVEIQNLHLFVVNSSVLPFGDSILDITIVAQ 302 >XP_013456276.1 basic helix loop helix (bHLH) DNA-binding family protein [Medicago truncatula] KEH30307.1 basic helix loop helix (bHLH) DNA-binding family protein [Medicago truncatula] Length = 329 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q H+GLLVKI+ +IQ LFV+NSS +PF DSILDIT+IAQ+ Sbjct: 251 RIQCQEHRGLLVKIMVEIQKYQLFVVNSSVIPFGDSILDITIIAQL 296 >ACU24264.1 unknown [Glycine max] Length = 222 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 KI Q +GLLVK++A+IQ+ HLFV NSS LPF +SILDIT++AQ+ Sbjct: 153 KIHCQKQRGLLVKLLAEIQSNHLFVANSSVLPFGNSILDITIVAQM 198 >XP_014619312.1 PREDICTED: transcription factor bHLH25-like isoform X2 [Glycine max] Length = 300 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+KI+ +IQ HLFV++SS LPF DSILDIT++AQ+ Sbjct: 231 RIHCQKQKGLLLKILVEIQKFHLFVVSSSVLPFGDSILDITIVAQM 276 >KYP53168.1 Transcription factor bHLH25 [Cajanus cajan] Length = 307 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLLVK++A+IQ+ +LFV+NSS LPF D+ILDIT++AQ+ Sbjct: 238 RIHCQKQKGLLVKLLAEIQSYNLFVVNSSVLPFGDTILDITIVAQM 283 >XP_003539216.1 PREDICTED: transcription factor bHLH25-like isoform X1 [Glycine max] KHN13037.1 Transcription factor bHLH25 [Glycine soja] KRH28295.1 hypothetical protein GLYMA_11G043600 [Glycine max] Length = 313 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q KGLL+KI+ +IQ HLFV++SS LPF DSILDIT++AQ+ Sbjct: 244 RIHCQKQKGLLLKILVEIQKFHLFVVSSSVLPFGDSILDITIVAQM 289 >KHN01700.1 Transcription factor bHLH25 [Glycine soja] Length = 371 Score = 59.3 bits (142), Expect = 4e-07 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 KI Q +GLLVK++A+IQ+ HLFV NSS LPF +SILDIT++AQ+ Sbjct: 302 KIHCQKQRGLLVKLLAEIQSNHLFVANSSVLPFGNSILDITIVAQM 347 >XP_003549987.1 PREDICTED: transcription factor bHLH18-like [Glycine max] ALA09149.1 bHLH transcription factor, partial [Glycine max] KRH04346.1 hypothetical protein GLYMA_17G155900 [Glycine max] Length = 371 Score = 59.3 bits (142), Expect = 4e-07 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 KI Q +GLLVK++A+IQ+ HLFV NSS LPF +SILDIT++AQ+ Sbjct: 302 KIHCQKQRGLLVKLLAEIQSNHLFVANSSVLPFGNSILDITIVAQM 347 >XP_013456258.1 basic helix loop helix (bHLH) DNA-binding family protein [Medicago truncatula] KEH30289.1 basic helix loop helix (bHLH) DNA-binding family protein [Medicago truncatula] Length = 332 Score = 58.9 bits (141), Expect = 5e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +2 Query: 230 KIIAQTHKGLLVKIIAKIQNLHLFVINSSGLPFKDSILDITVIAQV 367 +I Q HKGLLVKI+ +IQ LFV+NSS LPF +S LDIT+IAQ+ Sbjct: 256 RIQCQEHKGLLVKIMVEIQRYQLFVVNSSVLPFGESTLDITIIAQL 301