BLASTX nr result
ID: Glycyrrhiza31_contig00010681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00010681 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU26729.1 hypothetical protein TSUD_317270 [Trifolium subterran... 65 1e-11 XP_013468259.1 hypothetical protein MTR_1g067010 [Medicago trunc... 59 1e-08 KDP29061.1 hypothetical protein JCGZ_16450 [Jatropha curcas] 50 7e-06 >GAU26729.1 hypothetical protein TSUD_317270 [Trifolium subterraneum] Length = 60 Score = 64.7 bits (156), Expect = 1e-11 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 4/61 (6%) Frame = +1 Query: 79 MPRTTENVESPATKT----VRVPPKRGQIKAKIMTEFVRMVEEAGRAMCSKEKVAEESHP 246 M +T ENVES AT V +PPKRGQIKAKIMT+FV+ AGR+M SKEKV +ESH Sbjct: 1 MAKTNENVESIATTKSIVRVPLPPKRGQIKAKIMTQFVK----AGRSMFSKEKVEDESHD 56 Query: 247 S 249 S Sbjct: 57 S 57 >XP_013468259.1 hypothetical protein MTR_1g067010 [Medicago truncatula] KEH42296.1 hypothetical protein MTR_1g067010 [Medicago truncatula] Length = 130 Score = 58.5 bits (140), Expect = 1e-08 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 4/54 (7%) Frame = +1 Query: 79 MPRTTENVESPATK--TVRVP--PKRGQIKAKIMTEFVRMVEEAGRAMCSKEKV 228 M RT ENVES T TVR+P PKRGQIKAKIMT+FV+ AGRAM SKEK+ Sbjct: 1 MSRTNENVESIVTTKTTVRIPLPPKRGQIKAKIMTQFVK----AGRAMFSKEKI 50 >KDP29061.1 hypothetical protein JCGZ_16450 [Jatropha curcas] Length = 68 Score = 50.1 bits (118), Expect = 7e-06 Identities = 26/66 (39%), Positives = 44/66 (66%) Frame = +1 Query: 73 SIMPRTTENVESPATKTVRVPPKRGQIKAKIMTEFVRMVEEAGRAMCSKEKVAEESHPSK 252 +I TE+ E+ T+ +PPKRGQIK KI ++ MV +AG+A+ +K+K+ +E P + Sbjct: 2 AITDEATESPENKKTEIHMLPPKRGQIKVKIFSKLANMVAKAGKAL-NKKKI-KEDQPQQ 59 Query: 253 PHDSSN 270 P+ S++ Sbjct: 60 PNGSTS 65