BLASTX nr result
ID: Glycyrrhiza31_contig00010357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00010357 (630 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442442.1 telomerase activating protein Est1 [Medicago trun... 63 6e-08 GAU32809.1 hypothetical protein TSUD_152580 [Trifolium subterran... 58 2e-06 >XP_013442442.1 telomerase activating protein Est1 [Medicago truncatula] KEH16467.1 telomerase activating protein Est1 [Medicago truncatula] Length = 1040 Score = 62.8 bits (151), Expect = 6e-08 Identities = 36/66 (54%), Positives = 40/66 (60%) Frame = +2 Query: 74 YCECAASFCYWFKLHLCCLVIGCLLEFLWP*LVAGCCFYKRFC*ALQQARIKEDKQASLQ 253 YC AASFCY FKL LC LVIGC L+ K + + QAR KEDKQASLQ Sbjct: 976 YCGWAASFCYSFKLQLCGLVIGCCWSSFGLDLLQDVATTKDYA-EVSQARTKEDKQASLQ 1034 Query: 254 FKIRKK 271 FK+ KK Sbjct: 1035 FKVLKK 1040 >GAU32809.1 hypothetical protein TSUD_152580 [Trifolium subterraneum] Length = 996 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/71 (42%), Positives = 40/71 (56%) Frame = +3 Query: 3 GQSMWTGHHFV*CQYESIDGPSRLTANVLHPFATGSNSTFAALLLDVCWSFFGLDLLQAV 182 GQS+WTG +FV C+ + F +L++ CWS FGLDLLQ + Sbjct: 934 GQSIWTGRYFVYCKCAA-------------SFCYSFKLQLCSLVIGCCWSSFGLDLLQDI 980 Query: 183 ASTKDFAELFS 215 A+TKD+AELFS Sbjct: 981 ATTKDYAELFS 991