BLASTX nr result
ID: Glycyrrhiza31_contig00009716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00009716 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015971910.1 PREDICTED: cellulose synthase A catalytic subunit... 70 3e-11 XP_012076601.1 PREDICTED: cellulose synthase A catalytic subunit... 70 3e-11 KYP70177.1 Cellulose synthase A catalytic subunit 1 [UDP-forming... 69 4e-11 KRH52460.1 hypothetical protein GLYMA_06G069600 [Glycine max] 69 5e-11 KHN08123.1 Cellulose synthase A catalytic subunit 1 [UDP-forming... 69 5e-11 KHN07088.1 Cellulose synthase A catalytic subunit 1 [UDP-forming... 69 5e-11 XP_007137035.1 hypothetical protein PHAVU_009G094200g [Phaseolus... 69 5e-11 XP_003526416.1 PREDICTED: cellulose synthase A catalytic subunit... 69 5e-11 XP_003522623.1 PREDICTED: cellulose synthase A catalytic subunit... 69 5e-11 OAY27367.1 hypothetical protein MANES_16G120400 [Manihot esculenta] 68 1e-10 XP_014501049.1 PREDICTED: cellulose synthase A catalytic subunit... 67 2e-10 KGN60109.1 hypothetical protein Csa_3G878780 [Cucumis sativus] 67 2e-10 XP_008466397.1 PREDICTED: cellulose synthase A catalytic subunit... 67 2e-10 XP_004136343.1 PREDICTED: cellulose synthase A catalytic subunit... 67 2e-10 XP_015937454.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthas... 67 2e-10 XP_016169714.1 PREDICTED: cellulose synthase A catalytic subunit... 67 2e-10 XP_019416733.1 PREDICTED: cellulose synthase A catalytic subunit... 66 6e-10 OIV96492.1 hypothetical protein TanjilG_07884 [Lupinus angustifo... 66 6e-10 XP_017421719.1 PREDICTED: cellulose synthase A catalytic subunit... 65 8e-10 XP_010648652.1 PREDICTED: cellulose synthase A catalytic subunit... 65 8e-10 >XP_015971910.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Arachis duranensis] Length = 1079 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFTTE++ ++NGQCGINC Sbjct: 1045 WSVLLASIFSLLWVRIDPFTTETSKNANGQCGINC 1079 >XP_012076601.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Jatropha curcas] KDP33612.1 hypothetical protein JCGZ_07183 [Jatropha curcas] Length = 1084 Score = 69.7 bits (169), Expect = 3e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT++S SSNGQCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTSDSTASSNGQCGINC 1084 >KYP70177.1 Cellulose synthase A catalytic subunit 1 [UDP-forming] [Cajanus cajan] Length = 1084 Score = 69.3 bits (168), Expect = 4e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTSDSNKLTNGQCGINC 1084 >KRH52460.1 hypothetical protein GLYMA_06G069600 [Glycine max] Length = 931 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 897 WSVLLASIFSLLWVRIDPFTSDSNKLTNGQCGINC 931 >KHN08123.1 Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine soja] Length = 1084 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSDSNKLTNGQCGINC 1084 >KHN07088.1 Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine soja] Length = 1084 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSDSNKLTNGQCGINC 1084 >XP_007137035.1 hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris] ESW09029.1 hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris] Length = 1084 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSDSNRLTNGQCGINC 1084 >XP_003526416.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine max] KRH52459.1 hypothetical protein GLYMA_06G069600 [Glycine max] Length = 1084 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSDSNKLTNGQCGINC 1084 >XP_003522623.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine max] KRH61787.1 hypothetical protein GLYMA_04G067900 [Glycine max] Length = 1084 Score = 68.9 bits (167), Expect = 5e-11 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT++SN +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSDSNKLTNGQCGINC 1084 >OAY27367.1 hypothetical protein MANES_16G120400 [Manihot esculenta] Length = 1085 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNS-SNGQCGINC 297 WSILLASIFSLLWVRIDPFTT+S+ S SNGQCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTTDSSKSASNGQCGINC 1085 >XP_014501049.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Vigna radiata var. radiata] Length = 1084 Score = 67.4 bits (163), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT+ SN +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSGSNRLTNGQCGINC 1084 >KGN60109.1 hypothetical protein Csa_3G878780 [Cucumis sativus] Length = 1062 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT+ S ++NGQCGINC Sbjct: 1028 WSILLASIFSLLWVRIDPFTSASTKAANGQCGINC 1062 >XP_008466397.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Cucumis melo] Length = 1081 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT+ S ++NGQCGINC Sbjct: 1047 WSILLASIFSLLWVRIDPFTSASTKAANGQCGINC 1081 >XP_004136343.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Cucumis sativus] Length = 1081 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT+ S ++NGQCGINC Sbjct: 1047 WSILLASIFSLLWVRIDPFTSASTKAANGQCGINC 1081 >XP_015937454.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Arachis duranensis] Length = 1082 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT SN SS+GQCGI+C Sbjct: 1048 WSILLASIFSLLWVRIDPFTNGSNKSSSGQCGIDC 1082 >XP_016169714.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Arachis ipaensis] Length = 1083 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT SN SS+GQCGI+C Sbjct: 1049 WSILLASIFSLLWVRIDPFTNGSNKSSSGQCGIDC 1083 >XP_019416733.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Lupinus angustifolius] Length = 1082 Score = 65.9 bits (159), Expect = 6e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS LLASIFSLLWVRIDPFT ++N +S GQCGINC Sbjct: 1048 WSFLLASIFSLLWVRIDPFTKDNNKASGGQCGINC 1082 >OIV96492.1 hypothetical protein TanjilG_07884 [Lupinus angustifolius] Length = 1216 Score = 65.9 bits (159), Expect = 6e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS LLASIFSLLWVRIDPFT ++N +S GQCGINC Sbjct: 1182 WSFLLASIFSLLWVRIDPFTKDNNKASGGQCGINC 1216 >XP_017421719.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Vigna angularis] KOM41975.1 hypothetical protein LR48_Vigan04g217300 [Vigna angularis] BAT78176.1 hypothetical protein VIGAN_02082300 [Vigna angularis var. angularis] Length = 1084 Score = 65.5 bits (158), Expect = 8e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WS+LLASIFSLLWVRIDPFT+ S+ +NGQCGINC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSGSSRLTNGQCGINC 1084 >XP_010648652.1 PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Vitis vinifera] Length = 1084 Score = 65.5 bits (158), Expect = 8e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 401 WSILLASIFSLLWVRIDPFTTESNNSSNGQCGINC 297 WSILLASIFSLLWVRIDPFT+ S +++GQCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTSSSTKAASGQCGINC 1084