BLASTX nr result
ID: Glycyrrhiza31_contig00009657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00009657 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015965939.1 PREDICTED: uncharacterized protein LOC107489699 [... 57 1e-06 >XP_015965939.1 PREDICTED: uncharacterized protein LOC107489699 [Arachis duranensis] Length = 226 Score = 56.6 bits (135), Expect = 1e-06 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 30/111 (27%) Frame = +1 Query: 61 AVSPLVAEALCFREALVFAENMGMENIIVESDCLELIRA--------------------- 177 A S L AEA REA++ EN+ ++ I+E+D L++++ Sbjct: 104 ANSSLSAEAQALREAVILVENLNIQRAIIETDSLQIVQTLKSGDTIWEIDPIIQDIISIQ 163 Query: 178 ---------WIARNGNKAAHLIANLASKFLLPTNWVWNPPPLLAAVIGDEK 303 W R GN+ AH +A L K LLP +W PPP A +I E+ Sbjct: 164 KRLSNCGFTWTPREGNRLAHSLAALKLKNLLPASWPITPPPQTADIIRRER 214