BLASTX nr result
ID: Glycyrrhiza31_contig00009600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00009600 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP36831.1 Pentatricopeptide repeat-containing protein At2g25580... 206 1e-63 XP_016202505.1 PREDICTED: pentatricopeptide repeat-containing pr... 209 1e-61 XP_015973789.1 PREDICTED: pentatricopeptide repeat-containing pr... 209 1e-61 XP_019464213.1 PREDICTED: pentatricopeptide repeat-containing pr... 208 2e-61 XP_003524191.2 PREDICTED: pentatricopeptide repeat-containing pr... 207 2e-61 XP_019464211.1 PREDICTED: pentatricopeptide repeat-containing pr... 208 2e-61 XP_015958199.1 PREDICTED: pentatricopeptide repeat-containing pr... 205 2e-60 KHN47964.1 Pentatricopeptide repeat-containing protein [Glycine ... 199 1e-59 XP_016187737.1 PREDICTED: pentatricopeptide repeat-containing pr... 203 2e-59 XP_017408516.1 PREDICTED: pentatricopeptide repeat-containing pr... 201 8e-59 XP_017408521.1 PREDICTED: pentatricopeptide repeat-containing pr... 201 9e-59 XP_003532746.1 PREDICTED: pentatricopeptide repeat-containing pr... 199 3e-58 XP_014510182.1 PREDICTED: pentatricopeptide repeat-containing pr... 199 3e-58 XP_007159402.1 hypothetical protein PHAVU_002G235300g [Phaseolus... 195 8e-57 XP_012567922.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 6e-55 XP_004488760.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 7e-55 XP_010048240.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 9e-55 OMO91901.1 hypothetical protein COLO4_18026 [Corchorus olitorius] 190 9e-55 XP_006483319.1 PREDICTED: pentatricopeptide repeat-containing pr... 191 1e-54 XP_006450490.1 hypothetical protein CICLE_v10007521mg [Citrus cl... 191 1e-54 >KYP36831.1 Pentatricopeptide repeat-containing protein At2g25580 family [Cajanus cajan] Length = 391 Score = 206 bits (525), Expect = 1e-63 Identities = 99/112 (88%), Positives = 105/112 (93%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKDYGIVPSMAHFV VVDMI SIGHLDEAFEFIEKMPMEPS D+WET Sbjct: 143 GDIDEGMLHFESMSKDYGIVPSMAHFVRVVDMIGSIGHLDEAFEFIEKMPMEPSADIWET 202 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCRVHGNT LGDRCAELVE+LDPSR+N+QSKAGL+P KASDL K+ EKK Sbjct: 203 LMNLCRVHGNTGLGDRCAELVEQLDPSRVNDQSKAGLVPPKASDLTKEGEKK 254 >XP_016202505.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Arachis ipaensis] Length = 721 Score = 209 bits (531), Expect = 1e-61 Identities = 101/114 (88%), Positives = 108/114 (94%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKD+GIVPSMAHFVSVVDMI SIGHLDEAFEFIEKMPMEPSVDVWET Sbjct: 474 GDIDEGMLHFESMSKDFGIVPSMAHFVSVVDMIGSIGHLDEAFEFIEKMPMEPSVDVWET 533 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 +MNLCR HGNTELG RCAELVE+LDPSRL EQSKAGL+PVKASDL K+K++K A Sbjct: 534 MMNLCRAHGNTELGYRCAELVEQLDPSRLIEQSKAGLVPVKASDLTKEKDRKLA 587 >XP_015973789.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Arachis duranensis] Length = 721 Score = 209 bits (531), Expect = 1e-61 Identities = 101/114 (88%), Positives = 108/114 (94%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKD+GIVPSMAHFVSVVDMI SIGHLDEAFEFIEKMPMEPSVDVWET Sbjct: 474 GDIDEGMLHFESMSKDFGIVPSMAHFVSVVDMIGSIGHLDEAFEFIEKMPMEPSVDVWET 533 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 +MNLCR HGNTELG RCAELVE+LDPSRL EQSKAGL+PVKASDL K+K++K A Sbjct: 534 MMNLCRAHGNTELGYRCAELVEQLDPSRLIEQSKAGLVPVKASDLTKEKDRKLA 587 >XP_019464213.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial isoform X2 [Lupinus angustifolius] Length = 701 Score = 208 bits (529), Expect = 2e-61 Identities = 98/114 (85%), Positives = 108/114 (94%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHF+SM+KDYGIVPS+AHFVSVVDMI S GHLDEAFEF+EKMP+EPSVDVWET Sbjct: 454 GDIDEGMLHFQSMNKDYGIVPSLAHFVSVVDMIGSSGHLDEAFEFVEKMPVEPSVDVWET 513 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCR HGNTEL DRCAEL+E+LDPSRLN+QSK+GLLPVKASDL K+KEKK A Sbjct: 514 LMNLCRAHGNTELADRCAELIEQLDPSRLNDQSKSGLLPVKASDLNKEKEKKLA 567 >XP_003524191.2 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Glycine max] KRH58903.1 hypothetical protein GLYMA_05G155200 [Glycine max] Length = 665 Score = 207 bits (527), Expect = 2e-61 Identities = 100/112 (89%), Positives = 105/112 (93%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKDYGIVPSM HFVSVVDMI SIGHLDEAFEFIE+MPMEPS + WET Sbjct: 417 GDIDEGMLHFESMSKDYGIVPSMTHFVSVVDMIGSIGHLDEAFEFIERMPMEPSAETWET 476 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCRVHGNT LGDRCAELVE+LD SRLNEQSKAGL+PVKASDL K+KEKK Sbjct: 477 LMNLCRVHGNTGLGDRCAELVEQLDSSRLNEQSKAGLVPVKASDLTKEKEKK 528 >XP_019464211.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial isoform X1 [Lupinus angustifolius] XP_019464212.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial isoform X1 [Lupinus angustifolius] OIW00597.1 hypothetical protein TanjilG_14823 [Lupinus angustifolius] Length = 711 Score = 208 bits (529), Expect = 2e-61 Identities = 98/114 (85%), Positives = 108/114 (94%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHF+SM+KDYGIVPS+AHFVSVVDMI S GHLDEAFEF+EKMP+EPSVDVWET Sbjct: 464 GDIDEGMLHFQSMNKDYGIVPSLAHFVSVVDMIGSSGHLDEAFEFVEKMPVEPSVDVWET 523 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCR HGNTEL DRCAEL+E+LDPSRLN+QSK+GLLPVKASDL K+KEKK A Sbjct: 524 LMNLCRAHGNTELADRCAELIEQLDPSRLNDQSKSGLLPVKASDLNKEKEKKLA 577 >XP_015958199.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Arachis duranensis] XP_015958201.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Arachis duranensis] Length = 719 Score = 205 bits (522), Expect = 2e-60 Identities = 100/114 (87%), Positives = 107/114 (93%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKD+GIVPSMAHFVSVVDMI S GHLDEAFEFIEKMPMEPSVDVWET Sbjct: 472 GDIDEGMLHFESMSKDFGIVPSMAHFVSVVDMIGSNGHLDEAFEFIEKMPMEPSVDVWET 531 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 +MNLCR HGNTELG RCAELVE+LDPS L+EQSKAGL+PVKASDL K+K+KK A Sbjct: 532 MMNLCRAHGNTELGYRCAELVEQLDPSCLSEQSKAGLVPVKASDLTKEKDKKVA 585 >KHN47964.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 486 Score = 199 bits (505), Expect = 1e-59 Identities = 96/112 (85%), Positives = 103/112 (91%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGM HFESM+KDYGIVPSM HFVSVVDMI SIGHLDEAFEFIEKMPM+PS D+WET Sbjct: 205 GDIDEGMQHFESMNKDYGIVPSMTHFVSVVDMIGSIGHLDEAFEFIEKMPMKPSADIWET 264 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCRVHGNT LGD CAELVE+LD S LNEQSKAGL+PVKASDL K+KEK+ Sbjct: 265 LMNLCRVHGNTGLGDCCAELVEQLDSSCLNEQSKAGLVPVKASDLTKEKEKR 316 >XP_016187737.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Arachis ipaensis] XP_016187738.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Arachis ipaensis] Length = 719 Score = 203 bits (516), Expect = 2e-59 Identities = 99/114 (86%), Positives = 106/114 (92%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKD+GIVPSMAHFVSVVDMI S GHLDEAFEFIEKMPMEPSVDVWET Sbjct: 472 GDIDEGMLHFESMSKDFGIVPSMAHFVSVVDMIGSNGHLDEAFEFIEKMPMEPSVDVWET 531 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 +MNLCR HGNTELG RCAELVE+LDP L+EQSKAGL+PVKASDL K+K+KK A Sbjct: 532 MMNLCRAHGNTELGYRCAELVEQLDPLCLSEQSKAGLVPVKASDLTKEKDKKVA 585 >XP_017408516.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X1 [Vigna angularis] KOM30968.1 hypothetical protein LR48_Vigan01g052300 [Vigna angularis] BAT73665.1 hypothetical protein VIGAN_01117900 [Vigna angularis var. angularis] Length = 681 Score = 201 bits (510), Expect = 8e-59 Identities = 96/114 (84%), Positives = 105/114 (92%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESM +DYGI+PSM HFVSVVDMI SIGHLDEAFEFIEKM MEPS D+WET Sbjct: 434 GDIDEGMLHFESMIRDYGIIPSMTHFVSVVDMIGSIGHLDEAFEFIEKMTMEPSADIWET 493 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCRVHGN+ LGDRCAEL+E+LD SRL+EQSKAGL+PVKASDL K+KEKK A Sbjct: 494 LMNLCRVHGNSGLGDRCAELLEQLDSSRLSEQSKAGLVPVKASDLSKEKEKKLA 547 >XP_017408521.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X2 [Vigna angularis] Length = 690 Score = 201 bits (510), Expect = 9e-59 Identities = 96/114 (84%), Positives = 105/114 (92%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESM +DYGI+PSM HFVSVVDMI SIGHLDEAFEFIEKM MEPS D+WET Sbjct: 443 GDIDEGMLHFESMIRDYGIIPSMTHFVSVVDMIGSIGHLDEAFEFIEKMTMEPSADIWET 502 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCRVHGN+ LGDRCAEL+E+LD SRL+EQSKAGL+PVKASDL K+KEKK A Sbjct: 503 LMNLCRVHGNSGLGDRCAELLEQLDSSRLSEQSKAGLVPVKASDLSKEKEKKLA 556 >XP_003532746.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Glycine max] KRH42812.1 hypothetical protein GLYMA_08G113100 [Glycine max] KRH42813.1 hypothetical protein GLYMA_08G113100 [Glycine max] Length = 664 Score = 199 bits (505), Expect = 3e-58 Identities = 96/112 (85%), Positives = 103/112 (91%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGM HFESM+KDYGIVPSM HFVSVVDMI SIGHLDEAFEFIEKMPM+PS D+WET Sbjct: 416 GDIDEGMQHFESMNKDYGIVPSMTHFVSVVDMIGSIGHLDEAFEFIEKMPMKPSADIWET 475 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCRVHGNT LGD CAELVE+LD S LNEQSKAGL+PVKASDL K+KEK+ Sbjct: 476 LMNLCRVHGNTGLGDCCAELVEQLDSSCLNEQSKAGLVPVKASDLTKEKEKR 527 >XP_014510182.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like [Vigna radiata var. radiata] Length = 690 Score = 199 bits (506), Expect = 3e-58 Identities = 96/114 (84%), Positives = 105/114 (92%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESM +DYGI+PSMAHFVSVVDMI SIGHLDEAFEFIEKM MEPS D+WET Sbjct: 443 GDIDEGMLHFESMIRDYGIIPSMAHFVSVVDMIGSIGHLDEAFEFIEKMTMEPSADIWET 502 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCRVHGNT LGDRCAEL+E+LD SRL++QSKAGL+PVKAS L K+KEKK A Sbjct: 503 LMNLCRVHGNTGLGDRCAELLEQLDSSRLSDQSKAGLVPVKASVLSKEKEKKLA 556 >XP_007159402.1 hypothetical protein PHAVU_002G235300g [Phaseolus vulgaris] ESW31396.1 hypothetical protein PHAVU_002G235300g [Phaseolus vulgaris] Length = 679 Score = 195 bits (496), Expect = 8e-57 Identities = 93/114 (81%), Positives = 104/114 (91%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMS+DYGI+PSMAHFVSVVDMI S GHLDEAFEFIEKM MEP+ D+WET Sbjct: 432 GDIDEGMLHFESMSRDYGIMPSMAHFVSVVDMIGSTGHLDEAFEFIEKMTMEPNADIWET 491 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCRVHGNT LGD CAEL+E+LD SRL++QSKAGL+PVKA DL K++EKK A Sbjct: 492 LMNLCRVHGNTGLGDLCAELLEQLDSSRLSDQSKAGLVPVKALDLTKEREKKLA 545 >XP_012567922.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X2 [Cicer arietinum] XP_012567923.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X3 [Cicer arietinum] Length = 676 Score = 190 bits (483), Expect = 6e-55 Identities = 90/111 (81%), Positives = 99/111 (89%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKDYGIVPSMAH+VSVVDMI IGHLDEA EFIEKMP+EPS DVWET Sbjct: 428 GDIDEGMLHFESMSKDYGIVPSMAHYVSVVDMIGGIGHLDEALEFIEKMPLEPSADVWET 487 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEK 333 LMN+CRVHGNTELGDRC EL+EKLDP+RLNE+SK GLL + D K+KE+ Sbjct: 488 LMNMCRVHGNTELGDRCTELIEKLDPTRLNEKSKTGLLLEENPDSTKNKEQ 538 >XP_004488760.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X1 [Cicer arietinum] XP_012567921.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial-like isoform X1 [Cicer arietinum] Length = 697 Score = 190 bits (483), Expect = 7e-55 Identities = 90/111 (81%), Positives = 99/111 (89%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDIDEGMLHFESMSKDYGIVPSMAH+VSVVDMI IGHLDEA EFIEKMP+EPS DVWET Sbjct: 449 GDIDEGMLHFESMSKDYGIVPSMAHYVSVVDMIGGIGHLDEALEFIEKMPLEPSADVWET 508 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEK 333 LMN+CRVHGNTELGDRC EL+EKLDP+RLNE+SK GLL + D K+KE+ Sbjct: 509 LMNMCRVHGNTELGDRCTELIEKLDPTRLNEKSKTGLLLEENPDSTKNKEQ 559 >XP_010048240.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Eucalyptus grandis] KCW80444.1 hypothetical protein EUGRSUZ_C01788 [Eucalyptus grandis] Length = 718 Score = 190 bits (483), Expect = 9e-55 Identities = 87/112 (77%), Positives = 102/112 (91%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GDI EGMLH ESMSKDYGIVPSM H+VSVVDM+ GHLDEA EF+EKMP+EPSV +WET Sbjct: 470 GDISEGMLHLESMSKDYGIVPSMEHYVSVVDMLGRTGHLDEAMEFVEKMPLEPSVGIWET 529 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCR+HG+TELGDRCAELVE+LDPSRLNEQS++GL+PV AS++ K++EKK Sbjct: 530 LMNLCRIHGHTELGDRCAELVEQLDPSRLNEQSRSGLVPVTASEIAKEEEKK 581 >OMO91901.1 hypothetical protein COLO4_18026 [Corchorus olitorius] Length = 692 Score = 190 bits (482), Expect = 9e-55 Identities = 90/114 (78%), Positives = 101/114 (88%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GD +EGMLHF SMS +YGIVP+M H+V+VVDM+ S GHLDEA EFIEKMP+EPSVDVWET Sbjct: 445 GDTNEGMLHFASMSSEYGIVPAMEHYVAVVDMLGSTGHLDEALEFIEKMPLEPSVDVWET 504 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKKFA 342 LMNLCRVHG+ ELGDRCAELVE+LDPSRLNEQSKAGL+P+K SDL K EKK A Sbjct: 505 LMNLCRVHGHLELGDRCAELVEQLDPSRLNEQSKAGLIPLKDSDLTKRNEKKLA 558 >XP_006483319.1 PREDICTED: pentatricopeptide repeat-containing protein At4g32450, mitochondrial [Citrus sinensis] KDO61674.1 hypothetical protein CISIN_1g004114mg [Citrus sinensis] Length = 773 Score = 191 bits (484), Expect = 1e-54 Identities = 89/112 (79%), Positives = 101/112 (90%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GD+ EGMLHFESMSKDYGIVPSM H+VS+VDM+ S G+LDEA EFIEKMPMEP VDVWE Sbjct: 525 GDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEK 584 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCR+HGN ELGDRCAE+VE+LDPSRLNE+SKAGL+PV AS+L K+KE K Sbjct: 585 LMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENK 636 >XP_006450490.1 hypothetical protein CICLE_v10007521mg [Citrus clementina] ESR63730.1 hypothetical protein CICLE_v10007521mg [Citrus clementina] Length = 773 Score = 191 bits (484), Expect = 1e-54 Identities = 89/112 (79%), Positives = 101/112 (90%) Frame = +1 Query: 1 GDIDEGMLHFESMSKDYGIVPSMAHFVSVVDMIASIGHLDEAFEFIEKMPMEPSVDVWET 180 GD+ EGMLHFESMSKDYGIVPSM H+VS+VDM+ S G+LDEA EFIEKMPMEP VDVWE Sbjct: 525 GDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEK 584 Query: 181 LMNLCRVHGNTELGDRCAELVEKLDPSRLNEQSKAGLLPVKASDLIKDKEKK 336 LMNLCR+HGN ELGDRCAE+VE+LDPSRLNE+SKAGL+PV AS+L K+KE K Sbjct: 585 LMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENK 636