BLASTX nr result
ID: Glycyrrhiza31_contig00009512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00009512 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008356761.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-11 XP_013445058.1 cellulose synthase-like protein [Medicago truncat... 67 7e-11 XP_004510986.1 PREDICTED: cellulose synthase A catalytic subunit... 67 9e-11 ONK59719.1 uncharacterized protein A4U43_C08F9680 [Asparagus off... 64 1e-10 KYP69049.1 Cellulose synthase A catalytic subunit 3 [UDP-forming... 66 2e-10 XP_007133819.1 hypothetical protein PHAVU_011G211500g [Phaseolus... 66 2e-10 BAT89210.1 hypothetical protein VIGAN_06010400 [Vigna angularis ... 66 2e-10 XP_017433008.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-10 XP_010032436.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-10 XP_003540527.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-10 XP_014493802.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-10 XP_003542849.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-10 XP_008375180.1 PREDICTED: cellulose synthase A catalytic subunit... 66 2e-10 KHN37622.1 Cellulose synthase A catalytic subunit 3 [UDP-forming... 66 2e-10 KHN19454.1 Cellulose synthase A catalytic subunit 3 [UDP-forming... 66 2e-10 ONI20358.1 hypothetical protein PRUPE_2G011200 [Prunus persica] 65 3e-10 KDO83413.1 hypothetical protein CISIN_1g001413mg [Citrus sinensis] 65 3e-10 AKE81080.1 cellulose synthase 4.1 [Populus tomentosa] 65 3e-10 XP_011093547.1 PREDICTED: cellulose synthase A catalytic subunit... 65 3e-10 XP_002308955.1 cellulose synthase family protein [Populus tricho... 65 3e-10 >XP_008356761.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Malus domestica] Length = 171 Score = 66.2 bits (160), Expect = 2e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP +EECGINC Sbjct: 141 LASIFSLLWVRVDPFTTRVTGPDIEECGINC 171 >XP_013445058.1 cellulose synthase-like protein [Medicago truncatula] KEH19084.1 cellulose synthase-like protein [Medicago truncatula] Length = 1078 Score = 67.4 bits (163), Expect = 7e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGPK EECGINC Sbjct: 1048 LASIFSLLWVRVDPFTTRVTGPKAEECGINC 1078 >XP_004510986.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Cicer arietinum] Length = 1077 Score = 67.0 bits (162), Expect = 9e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTR+TGPK EECGINC Sbjct: 1047 LASIFSLLWVRVDPFTTRITGPKAEECGINC 1077 >ONK59719.1 uncharacterized protein A4U43_C08F9680 [Asparagus officinalis] Length = 171 Score = 64.3 bits (155), Expect = 1e-10 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP V++CGINC Sbjct: 141 LASIFSLLWVRVDPFTTRVTGPDVQQCGINC 171 >KYP69049.1 Cellulose synthase A catalytic subunit 3 [UDP-forming], partial [Cajanus cajan] Length = 1067 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1037 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1067 >XP_007133819.1 hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris] ESW05813.1 hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris] Length = 1074 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1044 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1074 >BAT89210.1 hypothetical protein VIGAN_06010400 [Vigna angularis var. angularis] Length = 1075 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1045 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1075 >XP_017433008.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Vigna angularis] KOM49289.1 hypothetical protein LR48_Vigan08g011600 [Vigna angularis] Length = 1075 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1045 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1075 >XP_010032436.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Eucalyptus grandis] XP_010032437.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Eucalyptus grandis] XP_018719709.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Eucalyptus grandis] KCW51830.1 hypothetical protein EUGRSUZ_J01278 [Eucalyptus grandis] Length = 1079 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1049 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1079 >XP_003540527.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine max] XP_014620595.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine max] KRH27476.1 hypothetical protein GLYMA_12G237000 [Glycine max] Length = 1079 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1049 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1079 >XP_014493802.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Vigna radiata var. radiata] Length = 1080 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1050 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1080 >XP_003542849.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine max] XP_006594411.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine max] XP_006594412.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine max] XP_006594413.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine max] KRH20820.1 hypothetical protein GLYMA_13G202500 [Glycine max] KRH20821.1 hypothetical protein GLYMA_13G202500 [Glycine max] Length = 1080 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1050 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1080 >XP_008375180.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Malus domestica] Length = 1082 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP +EECGINC Sbjct: 1052 LASIFSLLWVRVDPFTTRVTGPDIEECGINC 1082 >KHN37622.1 Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine soja] Length = 1091 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1061 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1091 >KHN19454.1 Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine soja] Length = 1093 Score = 66.2 bits (160), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVR+DPFTTRVTGP VEECGINC Sbjct: 1063 LASIFSLLWVRIDPFTTRVTGPDVEECGINC 1093 >ONI20358.1 hypothetical protein PRUPE_2G011200 [Prunus persica] Length = 499 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 469 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 499 >KDO83413.1 hypothetical protein CISIN_1g001413mg [Citrus sinensis] Length = 918 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 888 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 918 >AKE81080.1 cellulose synthase 4.1 [Populus tomentosa] Length = 972 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 942 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 972 >XP_011093547.1 PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] [Sesamum indicum] Length = 1047 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 1017 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1047 >XP_002308955.1 cellulose synthase family protein [Populus trichocarpa] EEE92478.1 cellulose synthase family protein [Populus trichocarpa] Length = 1058 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 LASIFSLLWVRVDPFTTRVTGPKVEECGINC 228 LASIFSLLWVRVDPFTTRVTGP VE+CGINC Sbjct: 1028 LASIFSLLWVRVDPFTTRVTGPDVEQCGINC 1058