BLASTX nr result
ID: Glycyrrhiza31_contig00009195
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00009195 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN06554.1 E3 ubiquitin-protein ligase RING1 [Glycine soja] 56 5e-07 KRH59281.1 hypothetical protein GLYMA_05G175400 [Glycine max] 56 6e-07 XP_006580255.1 PREDICTED: RING-H2 finger protein ATL52-like [Gly... 56 6e-07 XP_007159707.1 hypothetical protein PHAVU_002G260500g [Phaseolus... 54 2e-06 >KHN06554.1 E3 ubiquitin-protein ligase RING1 [Glycine soja] Length = 313 Score = 55.8 bits (133), Expect = 5e-07 Identities = 31/40 (77%), Positives = 32/40 (80%), Gaps = 4/40 (10%) Frame = -3 Query: 252 RVLQKRPIST----RRSFSHSRKFLFSSRHCRSQSSTLPL 145 R LQKRPIS RRSFSH+ KFLFS RHCRSQSSTLPL Sbjct: 275 RALQKRPISVSMRMRRSFSHNTKFLFS-RHCRSQSSTLPL 313 >KRH59281.1 hypothetical protein GLYMA_05G175400 [Glycine max] Length = 339 Score = 55.8 bits (133), Expect = 6e-07 Identities = 31/40 (77%), Positives = 32/40 (80%), Gaps = 4/40 (10%) Frame = -3 Query: 252 RVLQKRPIST----RRSFSHSRKFLFSSRHCRSQSSTLPL 145 R LQKRPIS RRSFSH+ KFLFS RHCRSQSSTLPL Sbjct: 301 RALQKRPISVSMRMRRSFSHNTKFLFS-RHCRSQSSTLPL 339 >XP_006580255.1 PREDICTED: RING-H2 finger protein ATL52-like [Glycine max] Length = 364 Score = 55.8 bits (133), Expect = 6e-07 Identities = 31/40 (77%), Positives = 32/40 (80%), Gaps = 4/40 (10%) Frame = -3 Query: 252 RVLQKRPIST----RRSFSHSRKFLFSSRHCRSQSSTLPL 145 R LQKRPIS RRSFSH+ KFLFS RHCRSQSSTLPL Sbjct: 326 RALQKRPISVSMRMRRSFSHNTKFLFS-RHCRSQSSTLPL 364 >XP_007159707.1 hypothetical protein PHAVU_002G260500g [Phaseolus vulgaris] ESW31701.1 hypothetical protein PHAVU_002G260500g [Phaseolus vulgaris] Length = 352 Score = 54.3 bits (129), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 252 RVLQKRPISTRRSFSHSRKFLFSSRHCRSQSSTLPL 145 R LQK P+S RRSFSH+RKFLFS+ H RSQSSTLP+ Sbjct: 318 RALQKGPVSMRRSFSHNRKFLFST-HSRSQSSTLPI 352