BLASTX nr result
ID: Glycyrrhiza31_contig00009015
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00009015 (534 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH71308.1 hypothetical protein GLYMA_02G140300 [Glycine max] 53 2e-06 >KRH71308.1 hypothetical protein GLYMA_02G140300 [Glycine max] Length = 79 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +3 Query: 102 YMHKKLRGMSSGSRSFINSLISGITLHMSDFGPGFIPL 215 Y+HKKLRGMSSGSR F+ ++S +TL +SDFGPGFIPL Sbjct: 34 YIHKKLRGMSSGSRPFM-QVVSDMTL-LSDFGPGFIPL 69