BLASTX nr result
ID: Glycyrrhiza31_contig00008958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00008958 (505 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507059.1 PREDICTED: putative F-box protein At3g16210 [Cice... 57 7e-07 XP_004512791.1 PREDICTED: F-box/kelch-repeat protein At3g06240-l... 57 2e-06 XP_004509851.1 PREDICTED: putative F-box protein At3g16210 [Cice... 57 2e-06 GAU25646.1 hypothetical protein TSUD_265720 [Trifolium subterran... 56 2e-06 XP_004517007.1 PREDICTED: putative F-box protein At3g16210 [Cice... 55 8e-06 XP_004506271.1 PREDICTED: putative F-box protein At3g16210, part... 55 8e-06 >XP_004507059.1 PREDICTED: putative F-box protein At3g16210 [Cicer arietinum] Length = 203 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 424 HATLYSLSGERFENKVKLDWPPPFQED 504 H LYSLSGER+ENKVKLDWPPPFQED Sbjct: 76 HPGLYSLSGERYENKVKLDWPPPFQED 102 >XP_004512791.1 PREDICTED: F-box/kelch-repeat protein At3g06240-like [Cicer arietinum] Length = 384 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 424 HATLYSLSGERFENKVKLDWPPPFQED 504 H LYSLSGER+ENKVKLDWPPPFQED Sbjct: 76 HPGLYSLSGERYENKVKLDWPPPFQED 102 >XP_004509851.1 PREDICTED: putative F-box protein At3g16210 [Cicer arietinum] Length = 386 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 385 EKTVLGHDGDNRDHATLYSLSGERFENKVKLDWPPPFQED 504 ++TV GH +H +LY LSGERFENKVKLDWP PFQED Sbjct: 72 KQTVPGH----ANHCSLYLLSGERFENKVKLDWPSPFQED 107 >GAU25646.1 hypothetical protein TSUD_265720 [Trifolium subterraneum] Length = 223 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 424 HATLYSLSGERFENKVKLDWPPPFQED 504 H TLY LSGERFENKVKLDWPPPF ED Sbjct: 88 HPTLYLLSGERFENKVKLDWPPPFLED 114 >XP_004517007.1 PREDICTED: putative F-box protein At3g16210 [Cicer arietinum] Length = 384 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 424 HATLYSLSGERFENKVKLDWPPPFQED 504 H LYSLSGER+ENKVKLDWPPPFQE+ Sbjct: 76 HPGLYSLSGERYENKVKLDWPPPFQEN 102 >XP_004506271.1 PREDICTED: putative F-box protein At3g16210, partial [Cicer arietinum] Length = 387 Score = 55.1 bits (131), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 424 HATLYSLSGERFENKVKLDWPPPFQED 504 H+TLY LSG+RFEN+VKLDWPPPF ED Sbjct: 99 HSTLYLLSGDRFENRVKLDWPPPFHED 125