BLASTX nr result
ID: Glycyrrhiza31_contig00008832
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00008832 (580 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19291.1 hypothetical protein TSUD_335770 [Trifolium subterran... 71 3e-12 >GAU19291.1 hypothetical protein TSUD_335770 [Trifolium subterraneum] Length = 161 Score = 71.2 bits (173), Expect = 3e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 578 AQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL 477 AQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL Sbjct: 128 AQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL 161