BLASTX nr result
ID: Glycyrrhiza31_contig00008602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00008602 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP37677.1 Protein IN2-1 isogeny B [Cajanus cajan] 152 2e-43 NP_001235146.1 In2-1 protein [Glycine max] AAG34872.1 In2-1 prot... 150 6e-43 ACU19145.1 unknown [Glycine max] 150 6e-43 XP_004497444.1 PREDICTED: glutathione S-transferase L3-like [Cic... 147 2e-41 NP_001304515.1 glutathione S-transferase L3 [Glycine max] KHN391... 146 4e-41 KYP37676.1 Protein IN2-1 isogeny B, partial [Cajanus cajan] 145 8e-41 XP_013468271.1 glutathione S-transferase tau [Medicago truncatul... 144 3e-40 XP_017407093.1 PREDICTED: glutathione S-transferase L3-like [Vig... 144 3e-40 ACJ84312.1 unknown [Medicago truncatula] 144 3e-40 XP_013468274.1 glutathione S-transferase tau [Medicago truncatul... 144 3e-40 XP_014491905.1 PREDICTED: glutathione S-transferase L3-like isof... 143 6e-40 XP_007144509.1 hypothetical protein PHAVU_007G161900g [Phaseolus... 142 9e-40 XP_006588742.1 PREDICTED: glutathione S-transferase L3 isoform X... 142 9e-40 XP_016183320.1 PREDICTED: glutathione S-transferase L3-like [Ara... 141 3e-39 XP_003625544.2 glutathione S-transferase [Medicago truncatula] A... 140 7e-39 XP_004493930.1 PREDICTED: glutathione S-transferase L3 [Cicer ar... 140 1e-38 XP_019443033.1 PREDICTED: glutathione S-transferase L3-like [Lup... 139 2e-38 XP_015949597.1 PREDICTED: glutathione S-transferase L3-like [Ara... 139 2e-38 BAC81649.1 glutathione S-transferase [Pisum sativum] 138 5e-38 NP_001304567.1 glutathione S-transferase L3 [Glycine max] AJE596... 138 6e-38 >KYP37677.1 Protein IN2-1 isogeny B [Cajanus cajan] Length = 264 Score = 152 bits (385), Expect = 2e-43 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAY+PFVERFQ+VFAEVFKHDITEGRPKL W EELNKIDAYTETRV Sbjct: 188 DGPFLLGQFSLVDIAYVPFVERFQVVFAEVFKHDITEGRPKLATWFEELNKIDAYTETRV 247 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFKKRFLPQQ Sbjct: 248 DPQEIVDLFKKRFLPQQ 264 >NP_001235146.1 In2-1 protein [Glycine max] AAG34872.1 In2-1 protein [Glycine max] KHN48339.1 Glutathione S-transferase L3 [Glycine soja] AJE59635.1 lambda class glutathione S-transferase [Glycine max] KRH19778.1 hypothetical protein GLYMA_13G135500 [Glycine max] Length = 237 Score = 150 bits (380), Expect = 6e-43 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKL W EELNK++AYTETRV Sbjct: 161 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLATWFEELNKLNAYTETRV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFKKRFLPQQ Sbjct: 221 DPQEIVDLFKKRFLPQQ 237 >ACU19145.1 unknown [Glycine max] Length = 237 Score = 150 bits (380), Expect = 6e-43 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKL W EELNK++AYTETRV Sbjct: 161 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLATWFEELNKLNAYTETRV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFKKRFLPQQ Sbjct: 221 DPQEIVDLFKKRFLPQQ 237 >XP_004497444.1 PREDICTED: glutathione S-transferase L3-like [Cicer arietinum] Length = 237 Score = 147 bits (370), Expect = 2e-41 Identities = 70/77 (90%), Positives = 73/77 (94%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPFVERF +VFAEVFKHDITEGRPKL WIEELNKIDAYT+TRV Sbjct: 161 DGPFLLGQFSLVDIAYIPFVERFHVVFAEVFKHDITEGRPKLGTWIEELNKIDAYTQTRV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 +PQEIVDLFK RFLPQQ Sbjct: 221 NPQEIVDLFKTRFLPQQ 237 >NP_001304515.1 glutathione S-transferase L3 [Glycine max] KHN39124.1 Glutathione S-transferase L3 [Glycine soja] AJE59634.1 lambda class glutathione S-transferase [Glycine max] KRH32371.1 hypothetical protein GLYMA_10G047700 [Glycine max] Length = 237 Score = 146 bits (368), Expect = 4e-41 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPF ERFQIVFAEVFKHDITEGRPKL W EELNK++AYTETRV Sbjct: 161 DGPFLLGQFSLVDIAYIPFAERFQIVFAEVFKHDITEGRPKLATWFEELNKLNAYTETRV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFKKRFL QQ Sbjct: 221 DPQEIVDLFKKRFLSQQ 237 >KYP37676.1 Protein IN2-1 isogeny B, partial [Cajanus cajan] Length = 249 Score = 145 bits (367), Expect = 8e-41 Identities = 71/74 (95%), Positives = 71/74 (95%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKL WIEELNKIDAYTETRV Sbjct: 153 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLAKWIEELNKIDAYTETRV 212 Query: 269 DPQEIVDLFKKRFL 228 DPQEIVDLFK RFL Sbjct: 213 DPQEIVDLFKTRFL 226 >XP_013468271.1 glutathione S-transferase tau [Medicago truncatula] KEH42308.1 glutathione S-transferase tau [Medicago truncatula] Length = 234 Score = 144 bits (362), Expect = 3e-40 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQ SLVDIAYIPFVERF IV AEVFKHDITEGRPKL WIEELNKIDAYT+TRV Sbjct: 158 DGPFLLGQLSLVDIAYIPFVERFHIVLAEVFKHDITEGRPKLATWIEELNKIDAYTQTRV 217 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFK RFLP+Q Sbjct: 218 DPQEIVDLFKNRFLPKQ 234 >XP_017407093.1 PREDICTED: glutathione S-transferase L3-like [Vigna angularis] Length = 237 Score = 144 bits (362), Expect = 3e-40 Identities = 66/77 (85%), Positives = 74/77 (96%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQ SLVDIAYIPFVERFQIVFAE+FKHDITEGRPKL W++ELNKIDAYTET+V Sbjct: 161 DGPFLLGQLSLVDIAYIPFVERFQIVFAELFKHDITEGRPKLAIWLKELNKIDAYTETKV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQE++DLFK+RFLP+Q Sbjct: 221 DPQEVIDLFKERFLPKQ 237 >ACJ84312.1 unknown [Medicago truncatula] Length = 237 Score = 144 bits (362), Expect = 3e-40 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQ SLVDIAYIPFVERF IV AEVFKHDITEGRPKL WIEELNKIDAYT+TRV Sbjct: 161 DGPFLLGQLSLVDIAYIPFVERFHIVLAEVFKHDITEGRPKLATWIEELNKIDAYTQTRV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFK RFLP+Q Sbjct: 221 DPQEIVDLFKNRFLPKQ 237 >XP_013468274.1 glutathione S-transferase tau [Medicago truncatula] AFK46174.1 unknown [Medicago truncatula] KEH42311.1 glutathione S-transferase tau [Medicago truncatula] Length = 237 Score = 144 bits (362), Expect = 3e-40 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQ SLVDIAYIPFVERF IV AEVFKHDITEGRPKL WIEELNKIDAYT+TRV Sbjct: 161 DGPFLLGQLSLVDIAYIPFVERFHIVLAEVFKHDITEGRPKLATWIEELNKIDAYTQTRV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEIVDLFK RFLP+Q Sbjct: 221 DPQEIVDLFKNRFLPKQ 237 >XP_014491905.1 PREDICTED: glutathione S-transferase L3-like isoform X2 [Vigna radiata var. radiata] Length = 237 Score = 143 bits (360), Expect = 6e-40 Identities = 65/77 (84%), Positives = 74/77 (96%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQ SLVDIAYIPFVERFQIVFAE+FKHDITEGRPK+ W++ELNKIDAYTET+V Sbjct: 161 DGPFLLGQLSLVDIAYIPFVERFQIVFAELFKHDITEGRPKIAIWLKELNKIDAYTETKV 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQE++DLFK+RFLP+Q Sbjct: 221 DPQEVIDLFKERFLPKQ 237 >XP_007144509.1 hypothetical protein PHAVU_007G161900g [Phaseolus vulgaris] ESW16503.1 hypothetical protein PHAVU_007G161900g [Phaseolus vulgaris] Length = 237 Score = 142 bits (359), Expect = 9e-40 Identities = 65/76 (85%), Positives = 71/76 (93%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPFVERF IVFAE FKHD+TEGRPK W++ELNKIDAYTET+V Sbjct: 161 DGPFLLGQFSLVDIAYIPFVERFHIVFAEAFKHDVTEGRPKFATWLKELNKIDAYTETKV 220 Query: 269 DPQEIVDLFKKRFLPQ 222 DPQ+I+DLFKKRFLPQ Sbjct: 221 DPQDIIDLFKKRFLPQ 236 >XP_006588742.1 PREDICTED: glutathione S-transferase L3 isoform X1 [Glycine max] Length = 239 Score = 142 bits (359), Expect = 9e-40 Identities = 68/74 (91%), Positives = 70/74 (94%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAYIPF ERFQIVFAEVFKHDITEGRPKL W EELNK++AYTETRV Sbjct: 161 DGPFLLGQFSLVDIAYIPFAERFQIVFAEVFKHDITEGRPKLATWFEELNKLNAYTETRV 220 Query: 269 DPQEIVDLFKKRFL 228 DPQEIVDLFKKRFL Sbjct: 221 DPQEIVDLFKKRFL 234 >XP_016183320.1 PREDICTED: glutathione S-transferase L3-like [Arachis ipaensis] Length = 237 Score = 141 bits (355), Expect = 3e-39 Identities = 65/77 (84%), Positives = 71/77 (92%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPF LGQFS VDIAYIPF+ERFQ+V AEVFKHDITEGRPKL AWIEE+NKIDAY +TR Sbjct: 161 DGPFFLGQFSWVDIAYIPFIERFQVVLAEVFKHDITEGRPKLRAWIEEVNKIDAYAQTRT 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DP+EIV+LFKKRFLPQQ Sbjct: 221 DPKEIVELFKKRFLPQQ 237 >XP_003625544.2 glutathione S-transferase [Medicago truncatula] AFK34993.1 unknown [Medicago truncatula] AES81762.2 glutathione S-transferase [Medicago truncatula] Length = 236 Score = 140 bits (353), Expect = 7e-39 Identities = 65/77 (84%), Positives = 70/77 (90%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPF LGQFS VDIAY+PFVERF IVF+EVFKHDITEGRPKL AWIEELNKIDAYT+TR Sbjct: 160 DGPFFLGQFSWVDIAYVPFVERFHIVFSEVFKHDITEGRPKLAAWIEELNKIDAYTQTRA 219 Query: 269 DPQEIVDLFKKRFLPQQ 219 DP EI+D+FKKRFL QQ Sbjct: 220 DPNEIIDIFKKRFLAQQ 236 >XP_004493930.1 PREDICTED: glutathione S-transferase L3 [Cicer arietinum] Length = 237 Score = 140 bits (352), Expect = 1e-38 Identities = 67/77 (87%), Positives = 70/77 (90%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPF LGQFS VDIAYIPFVERF IVF+EVFKHDITEGRPKL AWIEELNKIDAYT+TR Sbjct: 161 DGPFFLGQFSWVDIAYIPFVERFHIVFSEVFKHDITEGRPKLAAWIEELNKIDAYTQTRG 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DP EIVD+FKKRFL QQ Sbjct: 221 DPNEIVDIFKKRFLAQQ 237 >XP_019443033.1 PREDICTED: glutathione S-transferase L3-like [Lupinus angustifolius] Length = 237 Score = 139 bits (350), Expect = 2e-38 Identities = 65/77 (84%), Positives = 71/77 (92%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFS VD+AYIPFVERFQ VFA+VFKHD+TEGRPKL AWIEELNKIDAYT T+ Sbjct: 161 DGPFLLGQFSWVDVAYIPFVERFQTVFADVFKHDVTEGRPKLAAWIEELNKIDAYTHTKN 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DPQEI++LFKKRFL QQ Sbjct: 221 DPQEIINLFKKRFLSQQ 237 >XP_015949597.1 PREDICTED: glutathione S-transferase L3-like [Arachis duranensis] Length = 237 Score = 139 bits (350), Expect = 2e-38 Identities = 64/77 (83%), Positives = 70/77 (90%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPF LGQFS VDIAYIPF+ERFQ+V A+VFKHDITEGRPKL AWIEE+NKIDAY TR Sbjct: 161 DGPFFLGQFSWVDIAYIPFIERFQVVLADVFKHDITEGRPKLRAWIEEVNKIDAYARTRT 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DP+EIV+LFKKRFLPQQ Sbjct: 221 DPKEIVELFKKRFLPQQ 237 >BAC81649.1 glutathione S-transferase [Pisum sativum] Length = 234 Score = 138 bits (347), Expect = 5e-38 Identities = 64/77 (83%), Positives = 71/77 (92%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPFLLGQFSLVDIAY+PFVERF I+ E+FK+DITEGRPKL AWIEELNKIDAYTET+V Sbjct: 158 DGPFLLGQFSLVDIAYVPFVERFHIILPELFKYDITEGRPKLAAWIEELNKIDAYTETKV 217 Query: 269 DPQEIVDLFKKRFLPQQ 219 +PQE VD +KKRFLPQQ Sbjct: 218 NPQETVDTYKKRFLPQQ 234 >NP_001304567.1 glutathione S-transferase L3 [Glycine max] AJE59637.1 lambda class glutathione S-transferase [Glycine max] Length = 237 Score = 138 bits (347), Expect = 6e-38 Identities = 64/77 (83%), Positives = 70/77 (90%) Frame = -2 Query: 449 DGPFLLGQFSLVDIAYIPFVERFQIVFAEVFKHDITEGRPKLEAWIEELNKIDAYTETRV 270 DGPF LGQFS VDIAY+PFVERFQ+VFA+VFKHDITEGRPKL WIEE+NKI AYT+TR Sbjct: 161 DGPFFLGQFSWVDIAYVPFVERFQLVFADVFKHDITEGRPKLATWIEEVNKISAYTQTRA 220 Query: 269 DPQEIVDLFKKRFLPQQ 219 DP+EIVDLFKKRFL QQ Sbjct: 221 DPKEIVDLFKKRFLAQQ 237